KLF8 Rabbit Polyclonal Antibody

SKU TA329322

Rabbit Polyclonal anti-KLF8 antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KLF8 antibody: synthetic peptide directed towards the N terminal of human KLF8. Synthetic peptide located within the following region: LSFHKPKAPLQPASMLQAPIRPPKPQSSPQTLVVSTSTSDMSTSANIPTV
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 39 kDa
• Gene Name: Kruppel-like factor 8
• Database Link:
  NP_009181
  O95600
• Background: KLF8 is abnormally expressed in female patients with X autosome translocation t(X;21)(p11.2;q22.3) and non-syndromic mental retardation.
• Synonyms: BKLF3; ZNF741
• Note: Immunogen sequence homology: Human: 100%; Rabbit: 86%; Dog: 79%; Bovine: 79%; Horse: 77%

Reference Data

• Protein Families: Transcription Factors