KLF8 Rabbit Polyclonal Antibody
Product Data | |
Application | IHC, WB |
---|---|
Recommended Dilution | WB, IHC |
Reactivity | Human |
Antibody Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-KLF8 antibody: synthetic peptide directed towards the N terminal of human KLF8. Synthetic peptide located within the following region: LSFHKPKAPLQPASMLQAPIRPPKPQSSPQTLVVSTSTSDMSTSANIPTV |
Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Shipping | Blue Ice |
Predicted Protein Size | 39 kDa |
Gene Name | Kruppel-like factor 8 |
Database Link | |
Background | KLF8 is abnormally expressed in female patients with X autosome translocation t(X;21)(p11.2;q22.3) and non-syndromic mental retardation. |
Synonyms | BKLF3; ZNF741 |
Note | Immunogen sequence homology: Human: 100%; Rabbit: 86%; Dog: 79%; Bovine: 79%; Horse: 77% |
Reference Data | |
Protein Families | Transcription Factors |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.