Prdm4 Rabbit Polyclonal Antibody

SKU TA329315

Rabbit Polyclonal anti-Prdm4 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Prdm4 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Prdm4. Synthetic peptide located within the following region: HLKTCKEPSSSSSAQEEEDDESEEEDLADSMRTEDCRMGSAVYSTDESLS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 88 kDa
• Gene Name: PR domain containing 4
• Database Link:
  NP_857633
  Q80V63
• Background: Prdm4 may function as a transcription factor involved in cell differentiation.
• Synonyms: MGC45046; PFM1
• Note: Immunogen sequence homology: Rat: 100%; Human: 100%; Rabbit: 100%; Dog: 93%; Horse: 93%; Pig: 92%; Mouse: 92%; Yeast: 92%; Bovine: 92%

Reference Data