Taf6l Rabbit Polyclonal Antibody

SKU TA329306

Rabbit Polyclonal anti-Taf6l antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Rat
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Taf6l antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: PQLMKVALQDLQTNSKIAALLPYFVYVVSGVKSVSHDLEQLHRLLQVARS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 68 kDa
• Gene Name: TATA-box binding protein associated factor 6 like
• Database Link:
  NP_001101045
• Background: The function of this protein remains unknown.
• Synonyms: FLJ11136; MGC4288; PAF65-alpha; PAF65A
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 92%; Horse: 92%; Bovine: 85%; Zebrafish: 85%

Reference Data