PQBP1 Rabbit Polyclonal Antibody

CAT#: TA329292

Rabbit Polyclonal anti-PQBP1 antibody


USD 485.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Transient overexpression lysate of polyglutamine binding protein 1 (PQBP1), transcript variant 1
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Purified recombinant protein of Homo sapiens polyglutamine binding protein 1 (PQBP1), transcript variant 2, 20 µg
    • 20 ug

USD 867.00

Other products for "PQBP1"

Specifications

Product Data
Applications IHC, WB
Recommended Dilution WB, IHC
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-PQBP1 antibody: synthetic peptide directed towards the middle region of human PQBP1. Synthetic peptide located within the following region: PSCGLPYYWNADREEGKERRHHRREELAPYPKSKKAVSRKDEELDPMDPS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 30 kDa
Gene Name polyglutamine binding protein 1
Background PQBP1 is a nuclear polyglutamine-binding protein that contains a WW domain. Mutations in this gene are associated with X-linked mental retardation.
Synonyms MRX2; MRX55; MRXS3; MRXS8; NPW38; RENS1; SHS
Note Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Bovine: 93%; Mouse: 86%; Rabbit: 86%; Guinea pig: 86%
Reference Data
Protein Families Transcription Factors
Protein Pathways Spliceosome

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.