SPI1 Rabbit Polyclonal Antibody

SKU TA329273

Rabbit Polyclonal anti-SPI1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SPI1 antibody is: synthetic peptide directed towards the N-terminal region of Human SPI1. Synthetic peptide located within the following region: MEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPH
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 26 kDa
• Gene Name: Spi-1 proto-oncogene
• Database Link:
  NP_003111
  P17947
• Background: The function of this protein remains unknown.
• Synonyms: OF; PU.1; SFPI1; SPI-1; SPI-A
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Rat: 77%; Guinea pig: 77%

Reference Data

• Protein Families: Transcription Factors
• Protein Pathways: Acute myeloid leukemia, Pathways in cancer