MSX1 Rabbit Polyclonal Antibody

SKU TA329262

Rabbit Polyclonal anti-MSX1 antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MSX1 antibody: synthetic peptide directed towards the middle region of human MSX1. Synthetic peptide located within the following region: SLGAPDAPSSPRPLGHFSVGGLLKLPEDALVKAESPEKPERTPWMQSPRF
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 31 kDa
• Gene Name: msh homeobox 1
• Database Link:
  NP_002439
  P28360
• Background: Slightly proximal to the Huntington disease locus, the human MSX1 gene is deleted in patients with Wolf-Hirschhorn syndrome. This gene is also called HOX7. The Msx family of vertebrate HOX genes was originally isolated by homology to the Drosophila msh (muscle segment homeo box) gene. This is a candidate gene for human cleft palate.
• Synonyms: ECTD3; HOX7; HYD1; STHAG1
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Mouse: 86%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors