FOXM1 Rabbit Polyclonal Antibody

SKU
TA329179
Rabbit Polyclonal anti-FOXM1 antibody
$585.00
5 Days*
Specifications
Product Data
Application IHC, WB
Recommended Dilution WB, IHC
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-FOXM1 antibody: synthetic peptide directed towards the N terminal of human FOXM1. Synthetic peptide located within the following region: LKRRRLPLPVQNAPSETSEEEPKRSPAQQESNQAEASKEVAESNSCKFPA
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 88 kDa
Gene Name forkhead box M1
Database Link
Background This protein acts as a Transcriptional activatory factor. May play a role in the control of cell proliferation.
Synonyms FKHL16; FOXM1B; HFH-11; HFH11; HNF-3; INS-1; MPHOSPH2; MPP-2; MPP2; PIG29; TGT3; TRIDENT
Note Immunogen sequence homology: Human: 100%
Reference Data
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:FOXM1 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.