C2orf28 (ATRAID) Rabbit Polyclonal Antibody

SKU TA329155

Rabbit Polyclonal anti-C2orf28 antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C2orf28 antibody: synthetic peptide directed towards the C terminal of human C2orf28. Synthetic peptide located within the following region: VCADGFHGYKCMRQGSFSLLMFFGILGATTLSVSILLWATQRRKAKTS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 18 kDa
• Gene Name: all-trans retinoic acid induced differentiation factor
• Database Link:
  NP_057169
  Q6UW56
• Background: The exact function of C2orf28 remains unknown.This gene is thought to be involved in apoptosis, and may also be involved in hematopoietic development and differentiation. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene.
• Synonyms: APR--3; APR-3; APR3; C2orf28; HSPC013; p18; PRO240
• Note: Immunogen sequence homology: Human: 100%; Dog: 87%; Pig: 87%; Rat: 87%; Mouse: 87%; Bovine: 87%; Rabbit: 87%

Reference Data

• Protein Families: Druggable Genome, Transmembrane