C2orf28 (ATRAID) Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-C2orf28 antibody: synthetic peptide directed towards the C terminal of human C2orf28. Synthetic peptide located within the following region: VCADGFHGYKCMRQGSFSLLMFFGILGATTLSVSILLWATQRRKAKTS |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 18 kDa |
| Gene Name | all-trans retinoic acid induced differentiation factor |
| Database Link | |
| Background | The exact function of C2orf28 remains unknown.This gene is thought to be involved in apoptosis, and may also be involved in hematopoietic development and differentiation. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
| Synonyms | APR--3; APR-3; APR3; C2orf28; HSPC013; p18; PRO240 |
| Note | Immunogen sequence homology: Human: 100%; Dog: 87%; Pig: 87%; Rat: 87%; Mouse: 87%; Bovine: 87%; Rabbit: 87% |
| Reference Data | |
| Protein Categories | Intracellular Proteins, Membrane Proteins |
| Protein Families | Druggable Genome, Transmembrane |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
