RGS7 Rabbit Polyclonal Antibody

SKU TA329134

Rabbit Polyclonal anti-RGS7 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-RGS7 antibody is: synthetic peptide directed towards the N-terminal region of Human RGS7. Synthetic peptide located within the following region: GNNYGQTSNGVADESPNMLVYRKMEDVIARMQDEKNGIPIRTVKSFLSKI
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 46 kDa
• Gene Name: regulator of G-protein signaling 7
• Database Link:
  NP_002915
  P49802
• Background: RGS7 inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Activity on G(o)-alpha is specifically enhanced by the RGS6/GNG5 dimer. RGS7 may play a role in synaptic vesicle exocytosis and may play important role in the rapid regulation of neuronal excitability and the cellular responses to short-lived stimulations.
• Synonyms: OTTHUMP00000037994; regulator of G-protein signaling 7; regulator of G-protein signaling RGS7; regulator of G-protein signalling 7
• Note: Immunogen sequence homology: Human: 100%; Mouse: 100%; Bovine: 100%; Rat: 92%

Reference Data

• Protein Families: Druggable Genome