GFI1B Rabbit Polyclonal Antibody

SKU TA329111

Rabbit Polyclonal anti-GFI1B antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GFI1B antibody: synthetic peptide directed towards the N terminal of human GFI1B. Synthetic peptide located within the following region: MPRSFLVKSKMAHTYHQPRVQEDEPLWPPALTPVPRDQAPSNSPVLSTLF
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 38 kDa
• Gene Name: growth factor independent 1B transcriptional repressor
• Database Link:
  NP_004179
  Q5VTD9
• Background: GFI1B acts in the late stage of erythroid differentiation as a transcriptional repressor. GATA-1 and NF-Y both contribute to erythroid-specific transcriptional activation of the Gfi-1B promoter. This zinc finger protein mediates erythroid expansion and has a role in normal erythropoiesis.
• Synonyms: BDPLT17; ZNF163B
• Note: Immunogen sequence homology: Dog: 100%; Horse: 100%; Human: 100%; Pig: 93%; Goat: 83%; Mouse: 83%; Bovine: 83%; Rat: 82%

Reference Data