KIR2.3 (KCNJ4) Mouse Monoclonal Antibody [Clone ID: N25/35]

SKU 75-069

KIR2.3 (KCNJ4) mouse monoclonal antibody, clone N25/35

Product Data

• Clone Name: N25/35
• Application: IF, IHC, WB
• Recommended Dilution: Immunoblot (IB). ; Immunocytochemistry (ICC).; Immunohistochemistry (IHC)
• Reactivity: Human, Mouse, Rat
• Antibody Host: Mouse
• Isotype: IgG1
• Clonality: Monoclonal
• Immunogen: Fusion protein amino acids 390-445 (cytoplasmic C-terminus, EAAAAAAVAAGLGLEAGSKEEAGIIRMLEFGSHLDLERMQASLPLDNISYRRESAI) of human Kir2.3 (also known as Inward rectifier potassium channel subfamily J member 4, KCNJ4, Brain inwardly rectifying K(+) channel 2, Hippocampal inward rectifier, HIRK2, HRK1, HIR, IRK3 and BIR11, accession number P48050).; Mouse: 94% identity (54/57 amino acids identical); Rat: 94% identity (54/57 amino acids identical); <50% identity with Kir2.1 and Kir2.2
• Specificity: Does not cross-react with Kir2.1 or Kir2.2
• Buffer: State: Purified
• Conjugation: Unconjugated
• Shipping: Blue Ice
• Gene Name: potassium voltage-gated channel subfamily J member 4
• Database Link:
  P48050
• Synonyms: KCNJ4, Inward rectifier K(+) channel Kir2.3, Hippocampal inward rectifier, HIRK2, HRK1, HIR, Inward rectifier potassium channel 4
• Note: USERS will cite the UC Davis/NIH NeuroMab Facility in any publication(s) describing the research utilizing the MATERIALS. The suggested acknowledgment statement is as follows:; "The monoclonal antibody _ was developed by and/or obtained from the UC Davis/NIH NeuroMab Facility, supported by NIH grant U24NS050606 and maintained by the Department of Neurobiology, Physiology and Behavior, College of Biological Sciences, University of California, Davis, CA 95616."; Also, please include the complete clone number (e.g., N52A/42) and the Antibody Registry identification number (e.g., RRID:AB_2120479) to avoid ambiguity.; View Research License Agreement

Reference Data