KIR2.3 (KCNJ4) Mouse Monoclonal Antibody [Clone ID: N25/35]

SKU
75-069
KIR2.3 (KCNJ4) mouse monoclonal antibody, clone N25/35
  $700.00
3 Weeks*
Bulk/Customize
Specifications
Specifications
Product Data
Clone Name N25/35
Application IF, IHC, WB
Recommended Dilution Immunoblot (IB).
Immunocytochemistry (ICC).
Immunohistochemistry (IHC)
Reactivity Human, Mouse, Rat
Antibody Host Mouse
Isotype IgG1
Clonality Monoclonal
Immunogen Fusion protein amino acids 390-445 (cytoplasmic C-terminus, EAAAAAAVAAGLGLEAGSKEEAGIIRMLEFGSHLDLERMQASLPLDNISYRRESAI) of human Kir2.3 (also known as Inward rectifier potassium channel subfamily J member 4, KCNJ4, Brain inwardly rectifying K(+) channel 2, Hippocampal inward rectifier, HIRK2, HRK1, HIR, IRK3 and BIR11, accession number P48050).
Mouse: 94% identity (54/57 amino acids identical)
Rat: 94% identity (54/57 amino acids identical)
<50% identity with Kir2.1 and Kir2.2
Specificity Does not cross-react with Kir2.1 or Kir2.2
Buffer State: Purified
Conjugation Unconjugated
Shipping Blue Ice
Gene Name potassium voltage-gated channel subfamily J member 4
Database Link
Synonyms KCNJ4, Inward rectifier K(+) channel Kir2.3, Hippocampal inward rectifier, HIRK2, HRK1, HIR, Inward rectifier potassium channel 4
Note USERS will cite the UC Davis/NIH NeuroMab Facility in any publication(s) describing the research utilizing the MATERIALS. The suggested acknowledgment statement is as follows:
"The monoclonal antibody _ was developed by and/or obtained from the UC Davis/NIH NeuroMab Facility, supported by NIH grant U24NS050606 and maintained by the Department of Neurobiology, Physiology and Behavior, College of Biological Sciences, University of California, Davis, CA 95616."
Also, please include the complete clone number (e.g., N52A/42) and the Antibody Registry identification number (e.g., RRID:AB_2120479) to avoid ambiguity.
View Research License Agreement
Reference Data
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.