Products

cDNA Clones (23)
RNAi (12)
Gene Expression (7)
Proteins (4)
Antibodies (3)
Jump to Filters
View as table Download
Samm50 (NM_001004241) Rat Tagged Lenti ORF Clone
RR208059L3

USD 803.00

8 Weeks

Lenti ORF clone of Samm50 (Myc-DDK-tagged ORF) - Rat sorting and assembly machinery component 50 homolog (S. cerevisiae) (Samm50), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Samm50 (NM_001004241) Rat Tagged Lenti ORF Clone
RR208059L4

USD 803.00

8 Weeks

Lenti ORF clone of Samm50 (mGFP-tagged ORF) - Rat sorting and assembly machinery component 50 homolog (S. cerevisiae) (Samm50), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SAMM50 (NM_015380) Human Over-expression Lysate
LC414564

USD 134.00

In Stock

SAMM50 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Samm50 (NM_178614) Mouse Tagged ORF Clone Lentiviral Particle
MR222025L3V

USD 1,007.00

5 Weeks

Lenti ORF particles, Samm50 (Myc-DDK-tagged) - Mouse sorting and assembly machinery component 50 homolog (S. cerevisiae) (Samm50), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Samm50 (NM_178614) Mouse Tagged ORF Clone Lentiviral Particle
MR222025L4V

USD 1,007.00

5 Weeks

Lenti ORF particles, Samm50 (GFP-tagged) - Mouse sorting and assembly machinery component 50 homolog (S. cerevisiae) (Samm50), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Samm50 (NM_001004241) Rat Tagged ORF Clone Lentiviral Particle
RR208059L3V

USD 1,053.00

10 Weeks

Lenti ORF particles, Samm50 (Myc-DDK-tagged ORF) - Rat sorting and assembly machinery component 50 homolog (S. cerevisiae) (Samm50), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Samm50 (NM_001004241) Rat Tagged ORF Clone Lentiviral Particle
RR208059L4V

USD 1,053.00

10 Weeks

Lenti ORF particles, Samm50 (GFP-tagged ORF) - Rat sorting and assembly machinery component 50 homolog (S. cerevisiae) (Samm50), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SAMM50 Rabbit Polyclonal Antibody
TA331956

USD 539.00

5 Days

Rabbit Polyclonal Anti-SAMM50 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SAMM50 Antibody is: synthetic peptide directed towards the N-terminal region of Human SAMM50. Synthetic peptide located within the following region: GLGRTKDDIIICEIGDVFKAKNLIEVMRKSHEAREKLLRLGIFRQVDVLI
Human SAMM50 activation kit by CRISPRa
GA108554

USD 1,657.00

2 Weeks

SAMM50 CRISPRa kit - CRISPR gene activation of human SAMM50 sorting and assembly machinery component

Format 3 gRNAs (5ug each), 1 scramble ctrl (10ug) and 1 enhancer vector (10ug)
Mouse Samm50 activation kit by CRISPRa
GA207885

USD 1,657.00

2 Weeks

Samm50 CRISPRa kit - CRISPR gene activation of mouse SAMM50 sorting and assembly machinery component

Format 3 gRNAs (5ug each), 1 scramble ctrl (10ug) and 1 enhancer vector (10ug)
SAMM50 (NM_015380) Human Over-expression Lysate
LY414564

USD 436.00

5 Days

Transient overexpression lysate of sorting and assembly machinery component 50 homolog (S. cerevisiae) (SAMM50)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SAMM50 (NM_015380) Human Tagged Lenti ORF Clone
RC204029L3

USD 757.00

3 Weeks

Lenti ORF clone of Human sorting and assembly machinery component 50 homolog (S. cerevisiae) (SAMM50), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SAMM50 (NM_015380) Human Untagged Clone
SC108289

USD 457.00

In Stock

SAMM50 (untagged)-Human sorting and assembly machinery component 50 homolog (S. cerevisiae) (SAMM50)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
SAMM50 Human qPCR Template Standard (NM_015380)
HK206518

USD 389.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene SAMM50

Application Plasmid of exact quantity for transcript copy number calculation
SAMM50 Human qPCR Primer Pair (NM_015380)
HP211596

USD 142.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene SAMM50

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions). Before use, reconstitute the primer mix in 200 µl dH2O to make a final concentration of 10 µM.