SAMM50 Rabbit Polyclonal Antibody

SKU TA331956

Rabbit Polyclonal Anti-SAMM50 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SAMM50 Antibody is: synthetic peptide directed towards the N-terminal region of Human SAMM50. Synthetic peptide located within the following region: GLGRTKDDIIICEIGDVFKAKNLIEVMRKSHEAREKLLRLGIFRQVDVLI
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 52 kDa
• Gene Name: SAMM50 sorting and assembly machinery component
• Database Link:
  NP_056195
  Q9Y512
• Background: This gene encodes a component of the Sorting and Assembly Machinery (SAM) of the mitochondrial outer membrane. The Sam complex functions in the assembly of beta-barrel proteins into the outer mitochondrial membrane.
• Synonyms: CGI-51; OMP85; SAM50; TOB55; TRG-3; YNL026W
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%; Horse: 88%; Zebrafish: 85%

Reference Data