SAMM50 Rabbit Polyclonal Antibody

CAT#: TA331956

Rabbit Polyclonal Anti-SAMM50 Antibody

Product Images

Host: Rabbit; Target Name: SAMM50; Sample Tissue: A549 Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SAMM50 Antibody is: synthetic peptide directed towards the N-terminal region of Human SAMM50. Synthetic peptide located within the following region: GLGRTKDDIIICEIGDVFKAKNLIEVMRKSHEAREKLLRLGIFRQVDVLI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 52 kDa
• Gene Name: SAMM50 sorting and assembly machinery component
• Database Link:
  NP_056195
  Entrez Gene 25813 Human
  UniProt ID Q9Y512
• Background: This gene encodes a component of the Sorting and Assembly Machinery (SAM) of the mitochondrial outer membrane. The Sam complex functions in the assembly of beta-barrel proteins into the outer mitochondrial membrane.
• Synonyms: CGI-51; OMP85; SAM50; TOB55; TRG-3; YNL026W
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%; Horse: 88%; Zebrafish: 85%