Germany
Japan
United Kingdom
China
Lenti ORF clone of Human S-phase kinase-associated protein 2 (p45) (SKP2), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Research Areas
View as table Download
Lenti ORF clone of Human S-phase kinase-associated protein 2 (p45) (SKP2), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human S-phase kinase-associated protein 2 (p45) (SKP2), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti-ORF clone of SKP2 (mGFP-tagged)-Human S-phase kinase-associated protein 2 (p45) (SKP2), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Rabbit polyclonal SKP2 Antibody (Center)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SKP2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 156-185 amino acids from the Central region of human SKP2. |
Lenti-ORF clone of SKP2 (Myc-DDK-tagged)-Human S-phase kinase-associated protein 2 (p45) (SKP2), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SKP2 (mGFP-tagged)-Human S-phase kinase-associated protein 2 (p45) (SKP2), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
SKP2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF particles, SKP2 (Myc-DDK-tagged)-Human S-phase kinase-associated protein 2 (p45) (SKP2), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
SKP2 (untagged)-Human S-phase kinase-associated protein 2 (p45) (SKP2), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal anti-SKP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SKP2 antibody is: synthetic peptide directed towards the C-terminal region of Human SKP2. Synthetic peptide located within the following region: TLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQKPSCL |
Rabbit Polyclonal Anti-SKP2/p45 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SKP2/p45 Antibody: A synthesized peptide derived from human SKP2/p45 |
Active filters
Target Symbol
- SKP2
Pathways
- Cell cycle