Antibodies

Jump to Filters
View as table Download
CACNB1 Mouse Monoclonal Antibody [Clone ID: OTI3H6]
TA809369

USD 447.00

In Stock

CACNB1 mouse monoclonal antibody,clone OTI3H6

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
CACNB1 Mouse Monoclonal Antibody [Clone ID: OTI3H6]
CF809369

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) CACNB1 mouse monoclonal antibody,clone OTI3H6

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
CACNB1 Rabbit Polyclonal Antibody
TA338371

USD 539.00

5 Days

Rabbit Polyclonal Anti-CACNB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACNB1 antibody: synthetic peptide directed towards the N terminal of human CACNB1. Synthetic peptide located within the following region: EVFDPSPQGKYSKRKGRFKRSDGSTSSDTTSNSFVRQGSAESYTSRPSDS
CACNB1 Mouse Monoclonal Antibody [Clone ID: N7/18]
75-052

USD 640.00

3 Weeks

CACNB1 mouse monoclonal antibody, clone N7/18

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
CACNB1 Rabbit Polyclonal Antibody
TA338798

USD 539.00

5 Days

Rabbit Polyclonal Anti-CACNB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACNB1 antibody: synthetic peptide directed towards the middle region of human CACNB1. Synthetic peptide located within the following region: KVLQRLIKSRGKSQSKHLNVQIAASEKLAQCPPEMFDIILDENQLEDACE
CACNB1 Rabbit Polyclonal Antibody
TA349730

USD 380.00

In Stock

Rabbit Polyclonal Anti-CACNB1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CACNB1
Cacnb1 Rabbit Polyclonal Antibody
TA328764

USD 850.00

3 Weeks

Rabbit Polyclonal Anti-CaVBeta1

Applications IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)DRATGEHASVHEYPGE, corresponding to amino acid residues 456-471 of rat CaVÃ?1. Intracellular, adjacent to the C-terminus.
CACNB1 Rabbit Polyclonal Antibody
TA338797

USD 539.00

5 Days

Rabbit Polyclonal Anti-CACNB1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACNB1 antibody: synthetic peptide directed towards the middle region of human CACNB1. Synthetic peptide located within the following region: TRRPTPPASGNEMTNLAFELDPLELEEEEAELGEQSGSAKTSVSSVTTPP
CACNB1 Rabbit Polyclonal Antibody
TA369010

USD 380.00

4 Weeks

CACNB1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CACNB1
CACNB1 Mouse Monoclonal Antibody [Clone ID: OTI3H6]
TA809369S

USD 200.00

2 Days

CACNB1 mouse monoclonal antibody,clone OTI3H6

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
CACNB1 (C-term) Rabbit Polyclonal Antibody
AP50704PU-N

USD 580.00

2 Weeks

CACNB1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 542-572 amino acids from the C-terminal region of human CACNB1
CACNB1 Rabbit Polyclonal Antibody
TA338372

USD 539.00

5 Days

Rabbit Polyclonal Anti-CACNB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACNB1 antibody: synthetic peptide directed towards the N terminal of human CACNB1. Synthetic peptide located within the following region: DWWIGRLVKEGCEVGFIPSPVKLDSLRLLQEQKLRQNRLGSSKSGDNSSS
CACNB1 Rabbit Polyclonal Antibody
TA341719

USD 539.00

5 Days

Rabbit Polyclonal Anti-CACNB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACNB1 antibody: synthetic peptide directed towards the C terminal of human CACNB1. Synthetic peptide located within the following region: RTMATAALAASPAPVSNLQVQVLTSLRRNLGFWGGLESSQRGSVVPQEQE