CACNB1 Rabbit Polyclonal Antibody

CAT#: TA338798

Rabbit Polyclonal Anti-CACNB1 Antibody

Product Images

WB Suggested Anti-CACNB1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: COLO205 cell lysate

• 

  Host: Rabbit; Target Name: CACNB1; Sample Tissue: Human Fetal Muscle; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: CACNB1; Sample Tissue: Human Adult Placenta; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CACNB1 antibody: synthetic peptide directed towards the middle region of human CACNB1. Synthetic peptide located within the following region: KVLQRLIKSRGKSQSKHLNVQIAASEKLAQCPPEMFDIILDENQLEDACE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 58 kDa
• Gene Name: calcium voltage-gated channel auxiliary subunit beta 1
• Database Link:
  NP_954855
  Entrez Gene 782 Human
  UniProt ID Q02641
• Background: The protein encoded by this gene belongs to the calcium channel beta subunit family. It plays an important role in the calcium channel by modulating G protein inhibition, increasing peak calcium current, controlling the alpha-1 subunit membrane targeting and shifting the voltage dependence of activation and inactivation. Alternative splicing occurs at this locus and three transcript variants encoding three distinct isoforms have been identified. [provided by RefSeq, Jul 2008]
• Synonyms: CAB1; CACNLB1; CCHLB1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Other
• Protein Pathways: Arrhythmogenic right ventricular cardiomyopathy (ARVC), Cardiac muscle contraction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM), MAPK signaling pathway