Antibodies

View as table Download

Goat Polyclonal Anti-GAPDH Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat, Zebrafish
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 240 aa to the C-terminus of human GAPDH produced in E. coli.

1 star1 star1 star1 star1 star Reviews (1)

Rabbit polyclonal anti-GAPDH antibody, Loading control

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH derived from within residues 220 - 290 of Human GAPDH.

Goat polyclonal anti-GAPDH antibody(C-terminal), Loading control

Applications IF, IHC, PEP-ELISA, WB
Reactivities Human, Mouse, Rat (Expected from sequence similarity: Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence C-HQVVSSDFNSDT, from the C Terminus of the protein sequence according to NP_002037.2.

Goat Polyclonal Anti-GAPDH Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 240 aa to the C-terminus of human GAPDH produced in E. coli.

Rabbit Polyclonal SPT2 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen SPT2 antibody was raised against a 15 amino acid synthetic peptide near the carboxy terminus of human SPT2.

Rabbit polyclonal anti-GAPDH antibody, Loading control

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH derived from within residues 220 - 290 of Human GAPDH.

Goat Polyclonal Anti-GAPDH Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat, Zebrafish
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 240 aa to the C-terminus of human GAPDH produced in E. coli.

1 star1 star1 star1 star1 star Reviews (1)

Rabbit Polyclonal PON1 Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human, Dog, Rat
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit polyclonal anti-COX IV antibody, Loading control

Applications ChIP, ICC, ICC/IF, IHC, Simple Western, WB
Reactivities Human, Mouse, Bovine, Primate, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of the human COX4-1 protein (within residues 1-100). [Swiss-Prot# P13073]

Rabbit Polyclonal antibody to Citrate synthetase (citrate synthase)

Applications IF, IHC, WB
Reactivities Human, Mouse (Predicted: Pig, Rat, Xenopus, Zebrafish, Bovine, X. tropicalis)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 110 and 412 of Citrate synthetase (Uniprot ID#O75390)

Rabbit polyclonal antibody to PCCase beta (propionyl Coenzyme A carboxylase, beta polypeptide)

Applications IF, IHC, WB
Reactivities Human (Predicted: Mouse, Pig, Rat, Xenopus, Zebrafish, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 167 and 480 of PCCB (Uniprot ID#P05166)

Rabbit Polyclonal Anti-GLUD1 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GLUD1 antibody: synthetic peptide directed towards the N terminal of human GLUD1. Synthetic peptide located within the following region: AKAGVKINPKNYTDNELEKITRRFTMELAKKGFIGPGIDVPAPDMSTGER

Rabbit Polyclonal antibody to GAD67 (glutamate decarboxylase 1 (brain, 67kDa))

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat (Predicted: Chimpanzee)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 5 and 216 of GAD67 (Uniprot ID#Q99259)

Rabbit Polyclonal PKM2 Antibody

Applications FC, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB
Reactivities Bovine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to the internal region of human PKM2 protein (within residues 350-450). [Swiss-Prot# P14618]

Rabbit Polyclonal Anti-CBS Antibody

Applications IHC, WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CBS antibody: synthetic peptide directed towards the N terminal of human CBS. Synthetic peptide located within the following region: RCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNE