Antibodies

View as table Download

Goat Polyclonal Anti-CX43 Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 230 aa to the C-terminus of rat CX43 produced in E. coli.

Goat Polyclonal Anti-CX43 Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 230 aa to the C-terminus of rat CX43 produced in E. coli.

Rabbit Polyclonal Anti-CACNB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACNB1 antibody: synthetic peptide directed towards the N terminal of human CACNB1. Synthetic peptide located within the following region: EVFDPSPQGKYSKRKGRFKRSDGSTSSDTTSNSFVRQGSAESYTSRPSDS

Rabbit polyclonal Connexin 43 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Connexin 43.

Goat Polyclonal Anti-CX43 Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 230 aa to the C-terminus of rat CX43 produced in E. coli.

Rabbit Polyclonal Anti-CACNB2 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CACNB2

Rabbit polyclonal CACNG6 Antibody (Center)

Applications IF, IHC, WB
Reactivities Human (Predicted: Mouse)
Conjugation Unconjugated
Immunogen This CACNG6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 108-136 amino acids from the Central region of human CACNG6.

Rabbit Polyclonal Anti-CACNB4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACNB4 antibody: synthetic peptide directed towards the middle region of human CACNB4. Synthetic peptide located within the following region: FDGRISITRVTADISLAKRSVLNNPSKRAIIERSNTRISSLAEVQSEIERIF

Rabbit Polyclonal Anti-CACNB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACNB1 antibody: synthetic peptide directed towards the middle region of human CACNB1. Synthetic peptide located within the following region: KVLQRLIKSRGKSQSKHLNVQIAASEKLAQCPPEMFDIILDENQLEDACE

Rabbit Polyclonal Anti-CACNB1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CACNB1

Rabbit Polyclonal CACNB2 Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

GJA1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide mapping at the C-terminus of human Connexin 43

Rabbit polyclonal CACNA2D3 Antibody (C-term)

Applications FC, WB
Reactivities Human (Predicted: Mouse, Rat)
Conjugation Unconjugated
Immunogen This CACNA2D3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1026-1053 amino acids from the C-terminal region of human CACNA2D3.

Rabbit Polyclonal Connexin 43 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human Connexin 43.

Rabbit Polyclonal Anti-CACNA2D1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACNA2D1 antibody: synthetic peptide directed towards the middle region of human CACNA2D1. Synthetic peptide located within the following region: PKSQEPVTLDFLDAELENDIKVEIRNKMIDGESGEKTFRTLVKSQDERYI