Mouse Monoclonal Cytochrome c Antibody (7H8.2C12)
Applications | FC, ICC/IF, IHC, Immunoblotting, WB |
Reactivities | Human, Mouse, Canine, Drosophila, Equine, Mammalian |
Conjugation | Unconjugated |
Mouse Monoclonal Cytochrome c Antibody (7H8.2C12)
Applications | FC, ICC/IF, IHC, Immunoblotting, WB |
Reactivities | Human, Mouse, Canine, Drosophila, Equine, Mammalian |
Conjugation | Unconjugated |
USD 570.00
2 Weeks
Carbonic Anhydrase IX (CA9) Marker mouse monoclonal antibody, clone 66.4.C2 (PN-15), Purified
Applications | FC, IF, IHC, IP, WB |
Reactivities | Equine, Human |
Conjugation | Unconjugated |
USD 315.00
2 Weeks
Carbonic Anhydrase IX (CA9) Marker mouse monoclonal antibody, clone 66.4.C2 (PN-15), Purified
Applications | FC, IF, IHC, IP, WB |
Reactivities | Equine, Human |
Conjugation | Unconjugated |
Rabbit Polyclonal MUC-1 Antibody
Applications | FC, ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine |
Conjugation | Unconjugated |
Immunogen | Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL. |
Annexin A1 (ANXA1) (324-337) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Bovine, Canine, Human, Mouse, Porcine, Rat, Bat, Equine, Guinea Pig, Hamster, Monkey, Rabbit |
Conjugation | Unconjugated |
Immunogen | Peptide from the C Terminus of the protein sequence according to NP_000691.1 |
Rabbit Polyclonal CXCR7/RDC-1 Antibody
Applications | FC, ICC/IF, IHC, Simple Western, WB |
Reactivities | Human, Mouse, Rat, Bovine, Equine, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding amino acids 106-129 of human CXCR7/RDC1 was used as the immunogen, GenBank NP_064707.1. |
TLR7 (900-950) rabbit polyclonal antibody, Purified
Applications | FC, IHC, WB |
Reactivities | Bovine, Canine, Equine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide from a portion of amino acids 900-950 of Human TLR7 |
XPR1 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC |
Reactivities | Bovine, Bat, Canine, Chicken, Equine, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic 16 amino acid peptide from the N-terminal cytoplasmic domain of human XPR1. |
WNT3 (315-329) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Canine, Human, Mouse, Rat, Bovine, Bat, Chicken, Equine, Monkey, Porcine, Xenopus, Zebrafish |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide from an internal region of human WNT3 |
PPAR delta (PPARD) (430-441) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Bovine, Bat, Canine, Chicken, Equine, Hamster, Monkey, Mouse, Porcine, Rabbit, Rat, Zebrafish |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide from the C-terminus of human PPARD |
Rabbit Polyclonal NFkB p65 NLS Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Bovine, Equine, Primate |
Conjugation | Unconjugated |
Immunogen | A portion of the NFkB p65 NLS nuclear localization signal (NLS) (amino acids DTDDRHRIEEKRKRKT) was used as the immunogen for this antibody. |
Mouse Monoclonal TLR9 Antibody (26C593.2)
Applications | Block/Neutralize, CyTOF-ready, Dot, ELISA, FC, ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat, Canine, Equine, Primate |
Conjugation | Unconjugated |
FOXO3 (661-673) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Bovine, Bat, Canine, Chicken, Equine, Hamster, Monkey, Mouse, Porcine, Rabbit, Rat, Sheep |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide from C Terminus of human FKHRL1 / FOXO3A |
Rabbit Polyclonal SR1 Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Bovine, Canine, Equine, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to amino acids 45-76 of human Sorcin was used as immunogen, GenBank no NP-003121. |
HNF 4 alpha (HNF4A) (2-15) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Canine, Human, Porcine, Bat, Equine, Hamster, Monkey, Rabbit |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide from the N-terminus of human HNF4A / HNF4 (NP_849180.1; NP_000448.3; NP_849181.1) |