Iba1 (149-161) goat polyclonal antibody, Purified from goat serum by ammonium sulphate precipitation followed by antigen affinity chromatography using the immunizing peptide.
| Applications | ELISA, IHC, WB |
| Reactivities | Hamster, Human, Monkey, Mouse, Porcine, Rat, Bovine, Equine, Goat, Rabbit, Pig |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TGPPAKKAISELP, from the C-Terminus of protein sequence according to NP_116573.1NP_001614.3. |
Rabbit Polyclonal Antibody against Eg5
| Applications | ICC/IF, Immunoblotting, IP, WB |
| Reactivities | Human, Mouse, Bovine, Goat, Hamster, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Produced by immunization of rabbits with a recombinant segment of the coiled-coil domain of the human protein. |
Rabbit Polyclonal Antibody against TPX2
| Applications | FC, ICC/IF, IP, Simple Western, WB |
| Reactivities | Human, Mouse, Bovine, Goat, Hamster, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Produced by immunizing rabbits with a recombinant segment of the C-terminal domain of the human protein |
Rabbit Polyclonal Anti-RHOC Antibody
| Applications | IHC, WB |
| Reactivities | Human, Cow, Dog, Goat, Guinea Pig, Horse, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish, Brugia malayi |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RHOC Antibody: synthetic peptide directed towards the N terminal of human RHOC. Synthetic peptide located within the following region: VPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCF |
GAPDH mouse monoclonal antibody, clone 4G5
| Applications | ELISA, IF, WB |
| Reactivities | Bovine, Feline, Goat, Human, Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
Biotinylated Rabbit monoclonal to GAPDH
| Applications | ChIP, ICC, IHC, IP, WB |
| Reactivities | Human, Monkey, Mouse, Goat |
| Conjugation | Unconjugated |
Goat IgG (Fc) fragment Rabbit mAb
| Applications | WB |
| Reactivities | Goat, Widely Range |
| Conjugation | Unconjugated |
| Immunogen | Goat IgG |
Germany
Japan
United Kingdom
China
