Rabbit Polyclonal MUC-1 Antibody
| Applications | FC, ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL. |
Rabbit Polyclonal antibody to alpha 1a Adrenergic Receptor (adrenergic, alpha-1A-, receptor)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Bovine, Dog, Pig, Rabbit, Guinea Pig, Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide contain a sequence corresponding to a region within amino acids 206 and 260 of alpha 1a Adrenergic Receptor (Uniprot ID#P35348) |
TLR3 (514-657) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Bovine, Feline, Guinea Pig, Human, Monkey, Mouse, Porcine, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | TLR3 antibody was raised against recombinant protein fragment containing a sequence corresponding to a region within amino acids 514 and 657 of TLR3. |
Rabbit Polyclonal anti-CANX Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Chicken, Dog, Porcine, Monkey, Rabbit, Sheep, Xenopus, Hamster, Guinea Pig |
| Conjugation | Unconjugated |
| Immunogen | A 19 residue synthetic peptide based on canine calnexin and the peptide coupled to KLH. |
Calnexin (CANX) rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Canine, Bovine, Guinea Pig, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Sheep, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | CANX antibody was raised against synthetic peptide derived from sequence near the amino-terminus of canine Calnexin, conjugated to KLH |
Rabbit polyclonal antibody to GIRK1 (potassium inwardly-rectifying channel, subfamily J, member 3)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Guinea Pig, Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 248 and 501 of GIRK1 (Uniprot ID#P48549) |
Rabbit polyclonal antibody to Histamine H3 Receptor (histamine receptor H3)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Rat, Rabbit, Guinea Pig, Rhesus Monkey, Mouse) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 293 and 387 of Histamine H3 Receptor (Uniprot ID#Q9Y5N1) |
TSPAN17 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Bovine, Canine, Equine, Guinea Pig, Mouse, Rabbit, Rat, Yeast, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to the middle region of human TSPAN17 |
Rabbit polyclonal antibody to RAMP1 (receptor (G protein-coupled) activity modifying protein 1)
| Applications | WB |
| Reactivities | Human (Predicted: Mouse, Rat, Pig, Guinea Pig, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 84 and 148 of RAMP1 (Uniprot ID#O60894) |
Rabbit Polyclonal Anti-Calnexin -CT Antibody
| Applications | WB |
| Reactivities | Human, Monkey, Mouse, Rat, Bovine, Dog, Hamster, Rabbit, Pig, Quail, Sheep, Xenopus (weak), Guinea Pig, Drosophila (weak), Chicken (weak) |
| Conjugation | Unconjugated |
| Immunogen | Dog Calnexin C-terminal synthetic peptide conjugated to KLH. Identical to human, mouse and rat calnexin sequences over these residues. |
Germany
Japan
United Kingdom
China
