Antibodies

View as table Download

Rabbit Polyclonal Anti-GSR Antibody

Applications IF, WB
Reactivities Human, Mouse, Zebrafish
Conjugation Unconjugated
Immunogen The immunogen for Anti-GSR Antibody: synthetic peptide directed towards the N terminal of human GSR. Synthetic peptide located within the following region: PTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELP

Rabbit polyclonal GCLM Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This GCLM antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 246-274 amino acids from the C-terminal region of human GCLM.

Rabbit Polyclonal GSTP1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen GSTP1 antibody was raised against a 14 amino acid peptide from near the center of human GSTP1.

Rabbit Polyclonal antibody to PGD (phosphogluconate dehydrogenase)

Applications IF, IHC, WB
Reactivities Human (Predicted: Mouse, Chicken, Xenopus, Zebrafish, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 201 of PGD (Uniprot ID#P52209)

Rabbit Polyclonal IDH2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen IDH2 antibody was raised against a 17 amino acid synthetic peptide near the amino terminus of human IDH2.

GST3 (GSTP1) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A peptide mapping at the C-terminus of GSTpi of human origin