Glutathione Reductase (GSR) Rabbit Polyclonal Antibody

CAT#: TA336225

Rabbit Polyclonal Anti-GSR Antibody

Product Images

WB Suggested Anti-GSR Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Hela cell lysate

• 

  Lanes: 1: 40ug mouse heart lysate, 2: 40ug mouse heart lysate; Primary Antibody Dilution: 1: 1000; Secondary Antibody: Anti-rabbit HRP; Secondary Antibody Dilution: 1: 10000; Gene Name: GSR; Submitted by: Anonymous;

• 

  WB Suggested Anti-GSR Antibody; Positive Control: Lane 1: 10 ug untreated zebrafish head lysate Lane 2: 10 ug 3hr H2O2 treated zebrafish head lysate Lane 3: 10ug 6hr H2O2 treated zebrafish head lysate; Primary Antibody Dilution: 1: 1000; Secondary Antibody: Anti rabbit-HRP; Secondry Antibody Dilution: 1: 10, 000; Submitted by: Dr. Yuk Fai Leung, Purdue University

• 

  6Hum. Adult Placenta; Host: Rabbit; Target Name: CHAD; Sample Tissue: Human Adult Placenta; Antibody Dilution: 1.0 ug/ml

• 

  7Human HepG2; Host: Rabbit; Target Name: EGFL8; Sample Tissue: HepG2; Antibody Dilution: 1.0 ug/ml GSR is supported by BioGPS gene expression data to be expressed in HepG2

• 

  5Hum. Fetal Liver; Host: Rabbit; Target Name: FAM46C; Sample Tissue: Human Fetal Liver; Antibody Dilution: 1.0 ug/ml

• 4Hum. Fetal Lung; Host: Rabbit; Target Name: NSUN6; Sample Tissue: Human Fetal Lung; Antibody Dilution: 1.0 ug/ml

• 8Human 721_B; Host: Rabbit; Target Name: WT1; Sample Tissue: 721_B; Antibody Dilution: 1.0 ug/ml. GSR is supported by BioGPS gene expression data to be expressed in 721_B

• Rabbit Anti-GSR Antibody; Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue; Observed Staining: Cytoplasmic; Primary Antibody Concentration: 1: 100; Secondary Antibody: Donkey anti-Rabbit-Cy3; Secondary Antibody Concentration: 1: 200; Magnification: 20X; Exposure Time: 0.5–2.0 sec;

Show all 9 images

Specifications

Product Data

• Applications: IF, WB
• Recommended Dilution: WB, IF
• Reactivities: Human, Mouse, Zebrafish
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-GSR Antibody: synthetic peptide directed towards the N terminal of human GSR. Synthetic peptide located within the following region: PTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 56 kDa
• Gene Name: glutathione reductase
• Database Link:
  NP_000628
  Entrez Gene 14782 MouseEntrez Gene 2936 Human
  UniProt ID P00390
• Background: GSR belongs to the class-I pyridine nucleotide-disulfide oxidoreductase family. It maintains high levels of reduced glutathione in the cytosol. Both glutathione and glutathione reductase are inducible by D3T, and that upregulation of GSH biosynthesis underlies D3T-mediated cytoprotection against ROS/RNS-elicited injury to human vascular smooth muscle cells.
• Synonyms: HEL-75
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Rat: 93%; Bovine: 93%; Horse: 86%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Glutathione metabolism