Germany
Japan
United Kingdom
China
GFAP rabbit polyclonal antibody, Purified
| Applications | IF, IHC |
| Reactivities | Bovine, Guinea Pig, Human, Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified Human GFAP. |
Antibodies
View as table DownloadMSH alpha rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Guinea Pig, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against VEGFA
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Dog, Horse, Cow, Rat, Chicken, Guinea Pig |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of the human VEGFA protein sequence (between residues 150-250). [Swiss-Prot# P15692] |
Rabbit Anti-DOPA Decarboxylase, Human Antibody
| Applications | WB |
| Reactivities | Bovine, Dog, Human, Rabbit, Rat, Sheep, Guinea Pig |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to amino acid residues from the N-terminal region conjugated to KLH |
GluT-1 / GLAST Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Bovine, Gorilla, Human, Monkey, Mouse, Pig, Rabbit, Rat, Gibbon, Hamster, Horse (Predicted: Dog, Chicken, Guinea Pig) |
| Conjugation | Unconjugated |
| Immunogen | SLC1A3 / GluT-1 / GLAST antibody was raised against synthetic 19 amino acid peptide from cytoplasmic domain of human SLC1A3 / GLAST. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Bovine, Horse, Rabbit, Pig (100%); Panda, Dog, Opossum, Guinea pig, Turkey, Chicken (95%); Xenopus (84%). |
Neuropeptide Y (NPY) rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Chicken, Feline, Guinea Pig, Human, Rat, Zebrafish |
| Conjugation | Unconjugated |
Rabbit polyclonal antibody to RAMP1 (receptor (G protein-coupled) activity modifying protein 1)
| Applications | WB |
| Reactivities | Human (Predicted: Mouse, Rat, Pig, Guinea Pig, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 84 and 148 of RAMP1 (Uniprot ID#O60894) |
WNT7A Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Chimpanzee, Chicken, Dog, Xenopus, Gorilla, Human, Monkey, Mouse, Pig, Rabbit, Rat, Gibbon, Hamster, Horse, Orang-Utan, Guinea Pig |
| Conjugation | Unconjugated |
| Immunogen | WNT7A antibody was raised against synthetic 12 amino acid peptide from internal region of human WNT7A. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig, Guinea pig, Turkey, Zebra finch, Chicken, Platypus, Lizard, Xenopus (100%); Seabass (92%); Stickleback, Pufferfish, Zebrafish (83%). |
KCNH2 / HERG Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bovine, Dog, Human, Monkey, Mouse, Pig, Rabbit, Rat, Gibbon, Hamster, Horse (Predicted: Bat, Guinea Pig) |
| Conjugation | Unconjugated |
| Immunogen | KCNH2 / HERG antibody was raised against synthetic 16 amino acid peptide from internal region of human KCNH2 / Kv11.1. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Horse, Rabbit, Pig (100%); Bat, Guinea pig (94%). |
Rabbit Polyclonal Anti-FAM86A Antibody
| Applications | WB |
| Reactivities | Human (Predicted: Rat, Dog, Cow, Guinea Pig, Horse) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FAM86A Antibody is: synthetic peptide directed towards the C-terminal region of Human FAM86A. Synthetic peptide located within the following region: CREHQRAPEVYVAFTVRNPETCQLFTTELGRAGIRWEVEPRHEQKLFPYE |
GFAP rabbit polyclonal antibody, Purified
| Applications | IHC |
| Reactivities | Bovine, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Rat, Sheep |
| Conjugation | Unconjugated |
| Immunogen | GFAP isolated from Cow spinal cord |
Albumin rabbit polyclonal antibody, FITC
| Applications | ID, IF, IP, R |
| Reactivities | Guinea Pig |
| Conjugation | FITC |
| Immunogen | Albumin is isolated from Guinea Pig serum by sequential precipitation and purified by ion exchange chromatography and affinity chromatography. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Rabbit polyclonal antibody to L-xylulose reductase (dicarbonyl/L-xylulose reductase)
| Applications | WB |
| Reactivities | Human (Predicted: Mouse, Guinea Pig) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 182 and 244 of DCXR (Uniprot ID#Q7Z4W1) |
KCNJ6 / GIRK2 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Bovine, Dog, Gorilla, Human, Monkey, Mouse, Pig, Rabbit, Rat, Gibbon, Hamster, Horse, Orang-Utan, Guinea Pig (Predicted: Bat) |
| Conjugation | Unconjugated |
| Immunogen | KCNJ6 / GIRK2 antibody was raised against synthetic 18 amino acid peptide from N-terminus of human KCNJ6 / GIRK2. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Dog, Bovine, Horse, Rabbit, Pig, Guinea pig (100%); Panda, Bat (94%); Opossum (89%). |
Rabbit polyclonal Glutathione Peroxidase 4 antibody
| Applications | WB |
| Reactivities | Mouse, Rat, Guinea Pig |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids near the carboxyl terminus of mouse GPx4 protein. |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Guinea Pig
Antibody Hosts
- Rabbit
Isotypes
- IgG
Filter by
Target Symbol
- GFAP (3)
- GLG1 (2)
- HRH3 (2)
- ACTIN (1)
- AE2 (1)
- ALB (1)
- ALPHA 1A ADRENERGIC RECEPTOR (1)
- BETA ACTIN (1)
- CCKAR (1)
- CRLR (1)
- DCXR (1)
- DOPA DECARBOXYLASE (1)
- EAAT1 (1)
- FAM86A (1)
- GIRK1 (1)
- GIRK2 (1)
- GJA1 (1)
- GPX4 (1)
- KCNH2 (1)
- MUSCARINIC ACETYLCHOLINE RECEPTOR M3 (1)
- NEUROPEPTIDE Y (1)
- NQO1 (1)
- PPARG (1)
- PTBP1 (1)
- RAMP1 (1)
- RBPMS (1)
- RHOC (1)
- TM9SF3 (1)
- VEGFA (1)
- WNT7A (1)
Clonalities
Conjugates
Assay Types
Families
Pathways
- Neuroactive ligand-receptor interaction (6)
- Calcium signaling pathway (3)
- Vascular smooth muscle contraction (3)
- Cell adhesion molecules (CAMs) (2)
- Focal adhesion (2)
- Metabolic pathways (2)
- Pathways in cancer (2)
- Regulation of actin cytoskeleton (2)
- Adherens junction (1)
- Adipocytokine signaling pathway (1)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (1)
- Basal cell carcinoma (1)
- Bladder cancer (1)
- Cytokine-cytokine receptor interaction (1)
- Dilated cardiomyopathy (1)
- Hedgehog signaling pathway (1)
- Histidine metabolism (1)
- Hypertrophic cardiomyopathy (HCM) (1)
- Leukocyte transendothelial migration (1)
- Melanogenesis (1)
- Pancreatic cancer (1)
- Pathogenic Escherichia coli infection (1)
- Pentose and glucuronate interconversions (1)
- Phenylalanine metabolism (1)
- Renal cell carcinoma (1)
- Tight junction (1)
- Tryptophan metabolism (1)
- Tyrosine metabolism (1)
- VEGF signaling pathway (1)
- Vibrio cholerae infection (1)
- Viral myocarditis (1)
- Wnt signaling pathway (1)
- mTOR signaling pathway (1)