Antibodies

Download

Rabbit Polyclonal PD-L1 Antibody

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PD-L1 antibody was raised against a 17 amino acid synthetic peptide from near the center of human PD-L1. The immunogen is located within amino acids 60 - 110 of PD-L1.

Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E3

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated

Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E3

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated

Rabbit Polyclonal Antibody against XCT

Applications FC, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to a region within the N-terminus of the human XCT protein sequence (between residues 1-50).

Rabbit Polyclonal Nephrin Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin.

ABCC4 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ABCC4

Rabbit Polyclonal STIM1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen STIM1 antibody was raised against a 24 amino acid synthetic peptide from near the carboxy terminus of human STIM1. The immunogen is located within the last 50 amino acids of STIM1.

Rabbit Polyclonal RHBDD2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen RHBDD2 antibody was raised against an 18 amino acid peptide from near the center of human RHBDD2.

Rabbit polyclonal DDR1 (Tyr513) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human DDR1 around the phosphorylation site of tyrosine 513 (P-A-YP-R-L).
Modifications Phospho-specific

Anti-IL1RAP Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 22-356 amino acids of Human Interleukin-1 receptor accessory protein

Rabbit polyclonal Cytochrome P450 8B1 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 8B1.

Anti-NPY1R rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 370-384 amino acids of Human neuropeptide Y receptor Y1

Rabbit polyclonal anti-COX IV antibody, Loading control

Applications ChIP, ICC, ICC/IF, IHC, Simple Western, WB
Reactivities Human, Mouse, Bovine, Primate, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of the human COX4-1 protein (within residues 1-100). [Swiss-Prot# P13073]

Rabbit polyclonal PECAM-1 (Ab-713) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human PECAM-1 around the phosphorylation site of tyrosine 713 (T-V-YP-S-E).

Rabbit Polyclonal Anti-GABRA5 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GABRA5 antibody: synthetic peptide directed towards the middle region of human GABRA5. Synthetic peptide located within the following region: GTSNTTSVSVKPSEEKTSESKKTYNSISKIDKMSRIVFPVLFGTFNLVYW