Anti-PIWIL2 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide peptide corresponding to a region derived from 107-120 amino acids of human piwi-like 2 (Drosophila) |
Anti-PIWIL2 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide peptide corresponding to a region derived from 107-120 amino acids of human piwi-like 2 (Drosophila) |
Rabbit Polyclonal PIWI-L2 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | PIWI-L2 antibody was raised against a 17 amino acid synthetic peptide near the center of human PIWI-L2. |
Rabbit anti-PIWIL2 polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | peptide from the intermediate residues of human PIWIL2 protein. |
Rabbit Polyclonal Anti-PIWIL2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PIWIL2 antibody: synthetic peptide directed towards the N terminal of human PIWIL2. Synthetic peptide located within the following region: QVLELKSQRKTDSAEISIKIQMTKILEPCSDLCIPFYNVVFRRVMKLLDM |
Rabbit Polyclonal PIWI-L2 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | PIWI-L2 antibody was raised against a 14 amino acid synthetic peptide near the center of human PIWI-L2. |