Primary Antibodies

View as table Download

Rabbit Polyclonal Antibody against PHPT1 (C-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PHPT1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 88-117 amino acids from the C-terminal region of human PHPT1.

TPK1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of Human TPK1

Rabbit Polyclonal Antibody against PHPT1 (N-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PHPT1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human PHPT1.

MTMR6 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 114-143 amino acids from the N-terminal region of Human MTMR6.

Rabbit Polyclonal Anti-MTMR7 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-MTMR7 Antibody is: synthetic peptide directed towards the C-terminal region of Human MTMR7. Synthetic peptide located within the following region: NLKSSDPDLSANSDQESGVEDLSCRSPSGGEHAPSEDSGKDRDSDEAVFL

Rabbit Polyclonal Anti-MTMR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MTMR1 antibody: synthetic peptide directed towards the C terminal of human MTMR1. Synthetic peptide located within the following region: KEDVYTKTISLWSYINSQLDEFSNPFFVNYENHVLYPVASLSHLELWVNY

NFS1 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide - KLH conjugated - corresponding to the central region (between 120-149aa) of human NFS1

Rabbit Polyclonal Anti-NFS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-NFS1 Antibody: synthetic peptide directed towards the middle region of human NFS1. Synthetic peptide located within the following region: TTQTEHKCVLDSCRSLEAEGFQVTYLPVQKSGIIDLKELEAAIQPDTSLV

Rabbit Polyclonal Anti-TPK1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TPK1 Antibody: synthetic peptide directed towards the N terminal of human TPK1. Synthetic peptide located within the following region: WNKALLRACADGGANRLYDITEGERESFLPEFINGDFDSIRPEVREYYAT

Rabbit Polyclonal Anti-THTPA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-THTPA antibody is: synthetic peptide directed towards the N-terminal region of Human THTPA. Synthetic peptide located within the following region: KFLPGPGTEERLQELGGTLEYRVTFRDTYYDTPELSLMQADHWLRRREDS

MTMR6 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated

MTMR6 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human MTMR6

MTMR7 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of Human MTMR7

MTMR6 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human MTMR6

PHPT1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PHPT1