NFS1 Rabbit Polyclonal Antibody

CAT#: TA331805

Rabbit Polyclonal Anti-NFS1 Antibody

Product Images

WB Suggested Anti-NFS1 Antibody Titration: 0.3125ug/ml; Positive Control: Jurkat cell lysateNFS1 is supported by BioGPS gene expression data to be expressed in Jurkat

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-NFS1 Antibody: synthetic peptide directed towards the middle region of human NFS1. Synthetic peptide located within the following region: TTQTEHKCVLDSCRSLEAEGFQVTYLPVQKSGIIDLKELEAAIQPDTSLV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 50 kDa
• Gene Name: NFS1 cysteine desulfurase
• Database Link:
  NP_066923
  Entrez Gene 9054 Human
  UniProt ID Q9Y697
• Background: Iron-sulfur clusters are required for the function of many cellular enzymes. The protein encoded by this gene supplies inorganic sulfur to these clusters by removing the sulfur from cysteine, creating alanine in the process. This gene uses alternate in-frame translation initiation sites to generate mitochondrial forms and cytoplasmic/nuclear forms. Selection of the alternative initiation sites is determined by the cytosolic pH. The encoded protein belongs to the class-V family of pyridoxal phosphate-dependent aminotransferases. Two transcript variants encoding two different isoforms have been found for this gene.
• Synonyms: HUSSY-08; IscS; NIFS
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Dog: 93%; Rabbit: 93%; Yeast: 92%

Reference Data

• Protein Pathways: Thiamine metabolism