Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-RORB Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human RORB

Aryl hydrocarbon Receptor (AHR) (N-term) rabbit polyclonal antibody

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic AhR peptide - KLH conjugated

Rabbit polyclonal HNF4A Antibody (Center)

Applications FC, IF, IHC, WB
Reactivities Human, Rat (Predicted: Mouse)
Conjugation Unconjugated
Immunogen This HNF4A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 281-312 amino acids from the Central region of human HNF4A.

Rabbit Polyclonal Anti-NR2E1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR2E1 antibody: synthetic peptide directed towards the N terminal of human NR2E1. Synthetic peptide located within the following region: MSKPAGSTSRILDIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRTY

Rabbit Polyclonal Anti-NR2F2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human NR2F2

Rabbit Polyclonal antibody to NR0B1 (nuclear receptor subfamily 0, group B, member 1)

Applications IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 96 and 406 of NR0B1 (Uniprot ID#P51843)

Rabbit polyclonal RARA Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This RARA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 322-349 amino acids from the C-terminal region of human RARA.

Rabbit Polyclonal Anti-RXRA Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-RXRA antibody: synthetic peptide directed towards the N terminal of human RXRA. Synthetic peptide located within the following region: GPGIGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGF

Rabbit Polyclonal Anti-VDR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VDR antibody: synthetic peptide directed towards the N terminal of human VDR. Synthetic peptide located within the following region: EAMAASTSLPDPGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRS

Rabbit polyclonal anti-NR4A3 antibody

Applications IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NR4A3.

Rabbit Polyclonal ESRRB Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen ESRRB antibody was raised against a 19 amino acid synthetic peptide near the carboxy terminus of human ESRRB.

Anti-ESR1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 247-261 amino acids of Human estrogen receptor 1

Anti-RARA Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 200-419 amino acids of human retinoic acid receptor, alpha

Anti-PTGES3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Anti-PPARG Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1-15 amino acids of Human peroxisome proliferator-activated receptor gamma