Proteasome subunit alpha type 6 (PSMA6) (NM_001282232) Human Tagged ORF Clone

CAT#: RG236218

  • TrueORF®

PSMA6 (tGFP-tagged) - Human proteasome (prosome, macropain) subunit, alpha type, 6 (PSMA6), transcript variant 2

ORF Plasmid: DDK tGFP


  "NM_001282232" in other vectors (2)

Reconstitution Protocol

USD 530.00

2 Weeks*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 750.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 412.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


PSMA6 (Proteasome 20S alpha 6) mouse monoclonal antibody, clone OTI4C9 (formerly 4C9)
    • 100 ul

USD 447.00

Other products for "Proteasome subunit alpha type 6"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol Proteasome subunit alpha type 6
Synonyms IOTA; p27K; PROS27
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG236218 representing NM_001282232.
Blue=ORF Red=Cloning site Green=Tag(s)

GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG
GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC
ATGACCGGAATGACAGCTGACAGCAGATCCCAGGTACAGAGGGCACGCTATGAGGCAGCTAACTGGAAA
TACAAGTATGGCTATGAGATTCCTGTGGACATGCTGTGTAAAAGAATTGCCGATATTTCTCAGGTCTAC
ACACAGAATGCTGAAATGAGGCCTCTTGGTTGTTGTATGATTTTAATTGGTATAGATGAAGAGCAAGGC
CCTCAGGTATATAAGTGTGATCCTGCAGGTTACTACTGTGGGTTTAAAGCCACTGCAGCGGGAGTTAAA
CAAACTGAGTCAACCAGCTTCCTTGAAAAAAAAGTGAAGAAGAAATTTGATTGGACATTTGAACAGACA
GTGGAAACTGCAATTACATGCCTGTCTACTGTTCTATCAATTGATTTCAAACCTTCAGAAATAGAAGTT
GGAGTAGTGACAGTTGAAAATCCTAAATTCAGGATTCTTACAGAAGCAGAGATTGATGCTCACCTTGTT
GCTCTAGCAGAGAGAGAC

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAAAC
>Peptide sequence encoded by RG236218
Blue=ORF Red=Cloning site Green=Tag(s)

MTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQG
PQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEV
GVVTVENPKFRILTEAEIDAHLVALAERD

TRTRPLEMESDESGLPAMEIECRITGTLNGVEFELVGGGEGTPEQGRMTNKMKSTKGALTFSPYLLSHV
MGYGFYHFGTYPSGYENPFLHAINNGGYTNTRIEKYEDGGVLHVSFSYRYEAGRVIGDFKVMGTGFPED
SVIFTDKIIRSNATVEHLHPMGDNDLDGSFTRTFSLRDGGYYSSVVDSHMHFKSAIHPSILQNGGPMFA
FRRVEEDHSNTELGIVEYQHAFKTPDADAGEERV

Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001282232
ORF Size 501 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reference Data
RefSeq NM_001282232.1, NP_001269161.1
RefSeq Size 1139 bp
RefSeq ORF 504 bp
Locus ID 5687
UniProt ID P60900
Cytogenetics 14q13.2
Protein Families Druggable Genome, Protease, Stem cell - Pluripotency
Protein Pathways Proteasome
MW 19.3 kDa
Gene Summary The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Multiple transcript variants encoding several different isoforms have been found for this gene. A pseudogene has been identified on the Y chromosome. [provided by RefSeq, Aug 2013]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.