TRAF3 (NM_003300) Human Tagged ORF Clone

CAT#: RG218682

TRAF3 (GFP-tagged) - Human TNF receptor-associated factor 3 (TRAF3), transcript variant 3

Change vector?

  • TrueORF®

USD 629


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name TRAF3 (NM_003300) Human Tagged ORF Clone
Symbol TRAF3
Synonyms CAP-1; CAP1; CD40bp; CRAF1; IIAE5; LAP1
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG218682 representing NM_003300
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGTCGAGTAAAAAGATGGACTCTCCTGGCGCGCTGCAGACTAACCCGCCGCTAAAGCTGCACACTG
ACCGCAGTGCTGGGACGCCAGTTTTTGTCCCTGAACAAGGAGGTTACAAGGAAAAGTTTGTGAAGACCGT
GGAGGACAAGTACAAGTGTGAGAAGTGCCACCTGGTGCTGTGCAGCCCGAAGCAGACCGAGTGTGGGCAC
CGCTTCTGCGAGAGCTGCATGGCGGCCCTGCTGAGCTCTTCAAGTCCAAAATGTACAGCGTGTCAAGAGA
GCATCGTTAAAGATAAGGTGTTTAAGGATAATTGCTGCAAGAGAGAAATTCTGGCTCTTCAGATCTATTG
TCGGAATGAAAGCAGAGGTTGTGCAGAGCAGTTAATGCTGGGACATCTGCTGGTGCATTTAAAAAATGAT
TGCCATTTTGAAGAACTTCCATGTGTGCGTCCTGACTGCAAAGAAAAGGTCTTGAGGAAAGACCTGCGAG
ACCACGTGGAGAAGGCGTGTAAATACCGGGAAGCCACATGCAGCCACTGCAAGAGTCAGGTTCCGATGAT
CGCGCTGCAGAAACACGAAGACACCGACTGTCCCTGCGTGGTGGTGTCCTGCCCTCACAAGTGCAGCGTC
CAGACTCTCCTGAGGAGCGAGTTGAGTGCACACTTGTCAGAGTGTGTCAATGCCCCCAGCACCTGTAGTT
TTAAGCGCTATGGCTGCGTTTTTCAGGGGACAAACCAGCAGATCAAGGCCCACGAGGCCAGCTCCGCCGT
GCAGCACGTCAACCTGCTGAAGGAGTGGAGCAACTCGCTCGAAAAGAAGGTTTCCTTGTTGCAGAATGAA
AGTGTAGAAAAAAACAAGAGCATACAAAGTTTGCACAATCAGATATGTAGCTTTGAAATTGAAATTGAGA
GACAAAAGGAAATGCTTCGAAATAATGAATCCAAAATCCTTCATTTACAGCGAGTGATAGACAGCCAAGC
AGAGAAACTGAAGGAGCTTGACAAGGAGATCCGGCCCTTCCGGCAGAACTGGGAGGAAGCAGACAGCATG
AAGAGCAGCGTGGAGTCCCTCCAGAACCGCGTGACCGAGCTGGAGAGCGTGGACAAGAGCGCGGGGCAAG
TGGCTCGGAACACAGGCCTGCTGGAGTCCCAGCTGAGCCGGCATGACCAGATGCTGAGTGTGCACGACAT
CCGCCTAGCCGACATGGACCTGCGCTTCCAGGTCCTGGAGACCGCCAGCTACAATGGAGTGCTCATCTGG
AAGATTCGCGACTACAAGCGGCGGAAGCAGGAGGCCGTCATGGGGAAGACCCTGTCCCTTTACAGCCAGC
CTTTCTACACTGGTTACTTTGGCTATAAGATGTGTGCCAGGGTCTACCTGAACGGGGACGGGATGGGGAA
GGGGACGCACTTGTCGCTGTTTTTTGTCATCATGCGTGGAGAATATGATGCCCTGCTTCCTTGGCCGTTT
AAGCAGAAAGTGACACTCATGCTGATGGATCAGGGGTCCTCTCGACGTCATTTGGGAGATGCATTCAAGC
CCGACCCCAACAGCAGCAGCTTCAAGAAGCCCACTGGAGAGATGAATATCGCCTCTGGCTGCCCAGTCTT
TGTGGCCCAAACTGTTCTAGAAAATGGGACATATATTAAAGATGATACAATTTTTATTAAAGTCATAGTG
GATACTTCGGATCTGCCCGATCCC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG218682 representing NM_003300
Red=Cloning site Green=Tags(s)

MESSKKMDSPGALQTNPPLKLHTDRSAGTPVFVPEQGGYKEKFVKTVEDKYKCEKCHLVLCSPKQTECGH
RFCESCMAALLSSSSPKCTACQESIVKDKVFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKND
CHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQKHEDTDCPCVVVSCPHKCSV
QTLLRSELSAHLSECVNAPSTCSFKRYGCVFQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNE
SVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSM
KSSVESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIW
KIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPF
KQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIV
DTSDLPDP

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_003300
ORF Size 1704 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_003300.2, NP_003291
RefSeq Size 2428
RefSeq ORF 1707
Locus ID 7187
Cytogenetics 14q32.32
Domains zf-TRAF, zf-C3HC4, MATH
Protein Families Druggable Genome
Protein Pathways Toll-like receptor signaling pathway, RIG-I-like receptor signaling pathway, Pathways in cancer, Small cell lung cancer
Gene Summary The protein encoded by this gene is a member of the TNF receptor associated factor (TRAF) protein family. TRAF proteins associate with, and mediate the signal transduction from, members of the TNF receptor (TNFR) superfamily. This protein participates in the signal transduction of CD40, a TNFR family member important for the activation of the immune response. This protein is found to be a critical component of the lymphotoxin-beta receptor (LTbetaR) signaling complex, which induces NF-kappaB activation and cell death initiated by LTbeta ligation. Epstein-Barr virus encoded latent infection membrane protein-1 (LMP1) can interact with this and several other members of the TRAF family, which may be essential for the oncogenic effects of LMP1. Several alternatively spliced transcript variants encoding three distinct isoforms have been reported. [provided by RefSeq, Dec 2010].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.