PSMA2 (NM_002787) Human Tagged ORF Clone

CAT#: RG208272

  • TrueORF®

PSMA2 (tGFP-tagged) - Human proteasome (prosome, macropain) subunit, alpha type, 2 (PSMA2)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro

AAV Particle: DDK


  "NM_002787" in other vectors (6)

Reconstitution Protocol

USD 500.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 750.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 412.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


PSMA2 (Proteasome 20S alpha 2) mouse monoclonal antibody, clone OTI3D9 (formerly 3D9)
    • 100 ul

USD 447.00

Other products for "PSMA2"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol PSMA2
Synonyms HC3; MU; PMSA2; PSC2
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG208272 representing NM_002787
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGAGCGCGGGTACAGCTTTTCGCTGACTACATTCAGCCCGTCTGGTAAACTTGTCCAGATTGAAT
ATGCTTTGGCTGCTGTAGCTGGAGGAGCCCCGTCCGTGGGAATTAAAGCTGCAAATGGTGTGGTATTAGC
AACTGAGAAAAAACAGAAATCCATTCTGTATGATGAGCGAAGTGTACACAAAGTAGAACCAATTACCAAG
CATATAGGTTTGGTGTACAGTGGCATGGGCCCCGATTACAGAGTGCTTGTGCACAGAGCTCGAAAACTAG
CTCAACAATACTATCTTGTGTACCAAGAACCCATTCCTACAGCTCAGCTGGTACAGAGAGTAGCTTCTGT
GATGCAAGAATATACTCAGTCAGGTGGTGTTCGTCCATTTGGAGTTTCTTTACTTATTTGTGGTTGGAAT
GAGGGACGACCATATTTATTTCAGTCAGATCCATCTGGAGCTTACTTTGCCTGGAAAGCTACAGCAATGG
GAAAGAACTATGTGAATGGGAAGACTTTCCTTGAGAAAAGATATAATGAAGATCTGGAACTTGAAGATGC
CATTCATACAGCCATCTTAACCCTAAAGGAAAGCTTTGAAGGGCAAATGACAGAGGATAACATAGAAGTT
GGAATCTGCAATGAAGCTGGATTTAGGAGGCTTACTCCAACTGAAGTTAAGGATTACTTGGCTGCCATAG
CA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG208272 representing NM_002787
Red=Cloning site Green=Tags(s)

MAERGYSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAANGVVLATEKKQKSILYDERSVHKVEPITK
HIGLVYSGMGPDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEYTQSGGVRPFGVSLLICGWN
EGRPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNEDLELEDAIHTAILTLKESFEGQMTEDNIEV
GICNEAGFRRLTPTEVKDYLAAIA

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_002787
ORF Size 702 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_002787.5
RefSeq Size 1477 bp
RefSeq ORF 705 bp
Locus ID 5683
UniProt ID P25787
Cytogenetics 7p14.1
Domains proteasome
Protein Families Druggable Genome, Protease
Protein Pathways Proteasome
Gene Summary The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. [provided by RefSeq, Jul 2008]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.