Properdin(CFP) (NM_002621) Human Tagged ORF Clone

CAT#: RG204890

CFP (GFP-tagged) - Human complement factor properdin (CFP), transcript variant 1

Change vector?

  • TrueORF®

USD 629.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Properdin(CFP) (NM_002621) Human Tagged ORF Clone
Symbol CFP
Synonyms BFD; PFC; PFD; PROPERDIN
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG204890 representing NM_002621
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATCACAGAGGGAGCGCAGGCCCCTCGATTGTTGCTGCCGCCGCTGCTCCTGCTGCTCACCCTGCCAG
CCACAGGCTCAGACCCCGTGCTCTGCTTCACCCAGTATGAAGAATCCTCCGGCAAGTGCAAGGGCCTCCT
GGGGGGTGGTGTCAGCGTGGAAGACTGCTGTCTCAACACTGCCTTTGCCTACCAGAAACGTAGTGGTGGG
CTCTGTCAGCCTTGCAGGTCCCCACGATGGTCCCTTTGGTCCACATGGGCCCCCTGTTCGGTGACGTGCT
CTGAGGGCTCCCAGCTGCGGTACCGGCGCTGTGTGGGCTGGAATGGGCAGTGCTCTGGAAAGGTGGCACC
TGGGACCCTGGAGTGGCAGCTCCAGGCCTGTGAGGACCAGCAGTGCTGTCCTGAGATGGGCGGCTGGTCT
GGCTGGGGGCCCTGGGAGCCTTGCTCTGTCACCTGCTCCAAAGGGACCCGGACCCGCAGGCGAGCCTGTA
ATCACCCTGCTCCCAAGTGTGGGGGCCACTGCCCAGGACAGGCACAGGAATCAGAGGCCTGTGACACCCA
GCAGGTCTGCCCCACACACGGGGCCTGGGCCACCTGGGGCCCCTGGACCCCCTGCTCAGCCTCCTGCCAC
GGTGGACCCCACGAACCTAAGGAGACACGAAGCCGCAAGTGTTCTGCACCTGAGCCCTCCCAGAAACCTC
CTGGGAAGCCCTGCCCGGGGCTAGCCTACGAGCAGCGGAGGTGCACCGGCCTGCCACCCTGCCCAGTGGC
TGGGGGCTGGGGGCCTTGGGGCCCTGTGAGCCCCTGCCCTGTGACCTGTGGCCTGGGCCAGACCATGGAA
CAACGGACGTGCAATCACCCTGTGCCCCAGCATGGGGGCCCCTTCTGTGCTGGCGATGCCACCCGGACCC
ACATCTGCAACACAGCTGTGCCCTGCCCTGTGGATGGGGAGTGGGACTCGTGGGGGGAGTGGAGCCCCTG
TATCCGACGGAACATGAAGTCCATCAGCTGTCAAGAAATCCCGGGCCAGCAGTCACGCGGGAGGACCTGC
AGGGGCCGCAAGTTTGACGGACATCGATGTGCCGGGCAACAGCAGGATATCCGGCACTGCTACAGCATCC
AGCACTGCCCCTTGAAAGGATCATGGTCAGAGTGGAGTACCTGGGGGCTGTGCATGCCCCCCTGTGGACC
TAATCCTACCCGTGCCCGCCAGCGCCTCTGCACACCCTTGCTCCCCAAGTACCCGCCCACCGTTTCCATG
GTCGAAGGTCAGGGCGAGAAGAACGTGACCTTCTGGGGGAGACCGCTGCCACGGTGTGAGGAGCTACAAG
GGCAGAAGCTGGTGGTGGAGGAGAAACGACCATGTCTACACGTGCCTGCTTGCAAAGACCCTGAGGAAGA
GGAACTC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG204890 representing NM_002621
Red=Cloning site Green=Tags(s)

MITEGAQAPRLLLPPLLLLLTLPATGSDPVLCFTQYEESSGKCKGLLGGGVSVEDCCLNTAFAYQKRSGG
LCQPCRSPRWSLWSTWAPCSVTCSEGSQLRYRRCVGWNGQCSGKVAPGTLEWQLQACEDQQCCPEMGGWS
GWGPWEPCSVTCSKGTRTRRRACNHPAPKCGGHCPGQAQESEACDTQQVCPTHGAWATWGPWTPCSASCH
GGPHEPKETRSRKCSAPEPSQKPPGKPCPGLAYEQRRCTGLPPCPVAGGWGPWGPVSPCPVTCGLGQTME
QRTCNHPVPQHGGPFCAGDATRTHICNTAVPCPVDGEWDSWGEWSPCIRRNMKSISCQEIPGQQSRGRTC
RGRKFDGHRCAGQQQDIRHCYSIQHCPLKGSWSEWSTWGLCMPPCGPNPTRARQRLCTPLLPKYPPTVSM
VEGQGEKNVTFWGRPLPRCEELQGQKLVVEEKRPCLHVPACKDPEEEEL

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_002621
ORF Size 1407 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_002621.1, NP_002612
RefSeq Size 1701
Locus ID 5199
Cytogenetics Xp11.23
Domains tsp_1
Protein Families Secreted Protein
Gene Summary This gene encodes a plasma glycoprotein that positively regulates the alternative complement pathway of the innate immune system. This protein binds to many microbial surfaces and apoptotic cells and stabilizes the C3- and C5-convertase enzyme complexes in a feedback loop that ultimately leads to formation of the membrane attack complex and lysis of the target cell. Mutations in this gene result in two forms of properdin deficiency, which results in high susceptibility to meningococcal infections. Multiple alternatively spliced variants, encoding the same protein, have been identified.[provided by RefSeq, Feb 2009]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.