DAZL (NM_001190811) Human Tagged ORF Clone

CAT#: RC231158

DAZL (Myc-DDK-tagged)-Human deleted in azoospermia-like (DAZL), transcript variant 1

Change vector?

USD 485


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name DAZL (NM_001190811) Human Tagged ORF Clone
Symbol DAZL
Synonyms DAZH; DAZL1; DAZLA; SPGYLA
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC231158 representing NM_001190811
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCTCCCTCGTGTGGCGGCGACAGAAAAGCTCGCCTGACGCCATCTTTGCCGCACGAGTCTACTG
CAAATCCTGAAACTCCAAACTCAACCATCTCCAGAGAGGCCAGCACCCAGTCCTCATCAGCTGCAACCAG
CCAAGGCTATATTTTACCAGAAGGCAAAATCATGCCAAACACTGTTTTTGTTGGAGGAATTGATGTTAGG
ATGGATGAAACTGAGATTAGAAGCTTCTTTGCTAGATATGGTTCAGTGAAAGAAGTGAAGATAATCACTG
ATCGAACTGGTGTGTCCAAAGGCTATGGATTTGTTTCATTTTTTAATGACGTGGATGTGCAGAAGATAGT
AGAATCACAGATAAATTTCCATGGTAAAAAGCTGAAGCTGGGCCCTGCAATCAGGAAACAAAATTTATGT
GCTTATCATGTGCAGCCACGTCCTTTGGTTTTTAATCATCCTCCTCCACCACAGTTTCAGAATGTCTGGA
CTAATCCAAACACTGAAACTTATATGCAGCCCACAACCACGATGAATCCTATAACTCAGTATGTTCAGGC
ATATCCTACTTACCCAAATTCACCAGTTCAGGTCATCACTGGATATCAGTTGCCTGTATATAATTATCAG
ATGCCACCACAGTGGCCTGTTGGGGAGCAAAGGAGCTATGTTGTACCTCCGGCTTATTCAGCTGTTAACT
ACCACTGTAATGAAGTTGATCCAGGAGCTGAAGTTGTGCCAAATGAATGTTCAGTTCATGAAGCTACTCC
ACCCTCTGGAAATGGCCCACAAAAGAAATCTGTGGACCGAAGCATACAAACGGTGGTATCTTGTCTGTTT
AATCCAGAGAACAGACTGAGAAACTCTGTTGTTACTCAAGATGACTACTTCAAGGATAAAAGAGTGCATC
ACTTTAGAAGAAGTCGGGCAATGCTTAAATCTGTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC231158 representing NM_001190811
Red=Cloning site Green=Tags(s)

MAAPSCGGDRKARLTPSLPHESTANPETPNSTISREASTQSSSAATSQGYILPEGKIMPNTVFVGGIDVR
MDETEIRSFFARYGSVKEVKIITDRTGVSKGYGFVSFFNDVDVQKIVESQINFHGKKLKLGPAIRKQNLC
AYHVQPRPLVFNHPPPPQFQNVWTNPNTETYMQPTTTMNPITQYVQAYPTYPNSPVQVITGYQLPVYNYQ
MPPQWPVGEQRSYVVPPAYSAVNYHCNEVDPGAEVVPNECSVHEATPPSGNGPQKKSVDRSIQTVVSCLF
NPENRLRNSVVTQDDYFKDKRVHHFRRSRAMLKSV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001190811
ORF Size 945 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001190811.1, NP_001177740
RefSeq ORF 948
Locus ID 1618
Cytogenetics 3p24.3
MW 35.7 kDa
Gene Summary The DAZ (Deleted in AZoospermia) gene family encodes potential RNA binding proteins that are expressed in prenatal and postnatal germ cells of males and females. The protein encoded by this gene is localized to the nucleus and cytoplasm of fetal germ cells and to the cytoplasm of developing oocytes. In the testis, this protein is localized to the nucleus of spermatogonia but relocates to the cytoplasm during meiosis where it persists in spermatids and spermatozoa. Transposition and amplification of this autosomal gene during primate evolution gave rise to the DAZ gene cluster on the Y chromosome. Mutations in this gene have been linked to severe spermatogenic failure and infertility in males. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations