DAZL (NM_001190811) Human Tagged ORF Clone

CAT#: RC231158

Reviews ()
Write a review

DAZL (Myc-DDK-tagged)-Human deleted in azoospermia-like (DAZL), transcript variant 1



  "NM_001190811" in other vectors (5)

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol DAZL
Synonyms DAZH; DAZL1; DAZLA; SPGYLA
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC231158 representing NM_001190811
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCTCCCTCGTGTGGCGGCGACAGAAAAGCTCGCCTGACGCCATCTTTGCCGCACGAGTCTACTG
CAAATCCTGAAACTCCAAACTCAACCATCTCCAGAGAGGCCAGCACCCAGTCCTCATCAGCTGCAACCAG
CCAAGGCTATATTTTACCAGAAGGCAAAATCATGCCAAACACTGTTTTTGTTGGAGGAATTGATGTTAGG
ATGGATGAAACTGAGATTAGAAGCTTCTTTGCTAGATATGGTTCAGTGAAAGAAGTGAAGATAATCACTG
ATCGAACTGGTGTGTCCAAAGGCTATGGATTTGTTTCATTTTTTAATGACGTGGATGTGCAGAAGATAGT
AGAATCACAGATAAATTTCCATGGTAAAAAGCTGAAGCTGGGCCCTGCAATCAGGAAACAAAATTTATGT
GCTTATCATGTGCAGCCACGTCCTTTGGTTTTTAATCATCCTCCTCCACCACAGTTTCAGAATGTCTGGA
CTAATCCAAACACTGAAACTTATATGCAGCCCACAACCACGATGAATCCTATAACTCAGTATGTTCAGGC
ATATCCTACTTACCCAAATTCACCAGTTCAGGTCATCACTGGATATCAGTTGCCTGTATATAATTATCAG
ATGCCACCACAGTGGCCTGTTGGGGAGCAAAGGAGCTATGTTGTACCTCCGGCTTATTCAGCTGTTAACT
ACCACTGTAATGAAGTTGATCCAGGAGCTGAAGTTGTGCCAAATGAATGTTCAGTTCATGAAGCTACTCC
ACCCTCTGGAAATGGCCCACAAAAGAAATCTGTGGACCGAAGCATACAAACGGTGGTATCTTGTCTGTTT
AATCCAGAGAACAGACTGAGAAACTCTGTTGTTACTCAAGATGACTACTTCAAGGATAAAAGAGTGCATC
ACTTTAGAAGAAGTCGGGCAATGCTTAAATCTGTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC231158 representing NM_001190811
Red=Cloning site Green=Tags(s)

MAAPSCGGDRKARLTPSLPHESTANPETPNSTISREASTQSSSAATSQGYILPEGKIMPNTVFVGGIDVR
MDETEIRSFFARYGSVKEVKIITDRTGVSKGYGFVSFFNDVDVQKIVESQINFHGKKLKLGPAIRKQNLC
AYHVQPRPLVFNHPPPPQFQNVWTNPNTETYMQPTTTMNPITQYVQAYPTYPNSPVQVITGYQLPVYNYQ
MPPQWPVGEQRSYVVPPAYSAVNYHCNEVDPGAEVVPNECSVHEATPPSGNGPQKKSVDRSIQTVVSCLF
NPENRLRNSVVTQDDYFKDKRVHHFRRSRAMLKSV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001190811
ORF Size 945 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001190811.1, NP_001177740.1
RefSeq ORF 948 bp
Locus ID 1618
UniProt ID Q92904
Cytogenetics 3p24.3
MW 35.7 kDa
Gene Summary The DAZ (Deleted in AZoospermia) gene family encodes potential RNA binding proteins that are expressed in prenatal and postnatal germ cells of males and females. The protein encoded by this gene is localized to the nucleus and cytoplasm of fetal germ cells and to the cytoplasm of developing oocytes. In the testis, this protein is localized to the nucleus of spermatogonia but relocates to the cytoplasm during meiosis where it persists in spermatids and spermatozoa. Transposition and amplification of this autosomal gene during primate evolution gave rise to the DAZ gene cluster on the Y chromosome. Mutations in this gene have been linked to severe spermatogenic failure and infertility in males. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010]

Other Versions

Other products for "DAZL"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


Goat Polyclonal Antibody against DAZL
    • 100 ug

USD 429.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.