hnRNP R (HNRNPR) (NM_005826) Human Tagged ORF Clone

CAT#: RC224502

Reviews ()
Write a review

HNRNPR (Myc-DDK-tagged)-Human heterogeneous nuclear ribonucleoprotein R (HNRNPR), transcript variant 2



  "NM_005826" in other vectors (6)

Reconstitution Protocol

USD 589.00

USD 884.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "HNRNPR"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol HNRNPR
Synonyms hnRNP-R; HNRPR
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC224502 representing NM_005826
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTAATCAGGTGAATGGTAATGCGGTACAGTTAAAAGAAGAGGAAGAACCAATGGATACTTCCAGTG
TAACTCACACAGAACACTACAAGACACTGATAGAGGCAGGCCTCCCACAGAAGGTGGCAGAAAGACTTGA
TGAAATATTTCAGACAGGATTGGTAGCTTATGTCGATCTTGATGAAAGAGCAATTGATGCTCTCAGGGAA
TTTAATGAAGAAGGAGCTCTGTCTGTACTACAGCAGTTCAAGGAAAGTGACTTATCACATGTTCAGAACA
AAAGTGCATTTTTATGTGGAGTTATGAAGACCTACAGGCAGAGAGAGAAACAGGGGAGCAAGGTGCAAGA
GTCCACAAAGGGACCTGATGAAGCGAAGATCAAGGCCTTGCTTGAGAGAACTGGTTATACTCTGGATGTA
ACCACAGGACAGAGGAAGTATGGTGGTCCTCCACCAGACAGTGTGTACTCTGGCGTGCAACCTGGAATTG
GAACGGAGGTATTTGTAGGCAAAATACCAAGGGATTTATATGAGGATGAGTTGGTGCCCCTTTTTGAGAA
GGCCGGACCCATTTGGGATCTACGTCTTATGATGGATCCACTGTCCGGTCAGAATAGAGGGTATGCATTT
ATCACCTTCTGTGGAAAGGAAGCTGCACAGGAAGCCGTGAAACTGTGTGACAGCTATGAAATTCGCCCTG
GTAAACACCTTGGAGTGTGCATTTCTGTGGCAAACAACAGACTTTTTGTTGGATCCATTCCGAAGAATAA
GACTAAAGAAAACATTTTGGAAGAATTCAGTAAAGTCACAGAGGGTTTGGTGGACGTTATTCTCTATCAT
CAACCCGATGACAAAAAGAAGAATCGGGGGTTCTGCTTCCTTGAATATGAGGATCACAAGTCAGCAGCAC
AAGCCAGACGCCGGCTGATGAGTGGAAAAGTAAAAGTGTGGGGAAATGTAGTTACAGTTGAATGGGCTGA
CCCTGTGGAAGAACCAGATCCAGAAGTCATGGCTAAGGTAAAAGTTTTGTTTGTGAGAAACTTGGCTACT
ACGGTGACAGAAGAAATATTGGAAAAGTCATTTTCTGAATTTGGAAAACTCGAAAGAGTAAAGAAGTTGA
AAGATTATGCATTTGTTCATTTTGAAGACAGAGGAGCAGCTGTTAAGGCTATGGATGAAATGAATGGCAA
AGAAATAGAAGGGGAAGAAATTGAAATAGTCTTAGCCAAGCCACCAGACAAGAAAAGGAAAGAGCGCCAA
GCTGCTAGACAGGCCTCCAGAAGCACTGCGTATGAAGATTATTACTACCACCCTCCTCCTCGCATGCCAC
CTCCAATTAGAGGTCGGGGTCGTGGTGGGGGGAGAGGTGGATATGGCTACCCTCCAGATTACTACGGCTA
TGAAGATTACTATGATGATTACTATGGTTATGATTATCACGACTATCGTGGAGGCTATGAAGATCCCTAC
TACGGCTATGATGATGGCTATGCAGTAAGAGGAAGAGGAGGAGGAAGGGGAGGGCGAGGTGCTCCACCAC
CACCAAGGGGGAGGGGAGCACCACCTCCAAGAGGTAGAGCTGGCTATTCACAGAGGGGGGCACCTTTGGG
ACCACCAAGAGGCTCTAGGGGTGGCAGAGGGGGTCCTGCTCAACAGCAGAGAGGCCGTGGTTCCCGTGGA
TCTCGGGGCAATCGTGGGGGCAATGTAGGAGGCAAGAGAAAGGCAGATGGGTACAACCAGCCTGATTCCA
AGCGTCGTCAGACCAACAACCAACAGAACTGGGGTTCCCAACCCATCGCTCAGCAGCCGCTTCAGCAAGG
TGGTGACTATTCTGGTAACTATGGTTACAATAATGACAACCAGGAATTTTATCAGGATACTTATGGGCAA
CAGTGGAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC224502 representing NM_005826
Red=Cloning site Green=Tags(s)

MANQVNGNAVQLKEEEEPMDTSSVTHTEHYKTLIEAGLPQKVAERLDEIFQTGLVAYVDLDERAIDALRE
FNEEGALSVLQQFKESDLSHVQNKSAFLCGVMKTYRQREKQGSKVQESTKGPDEAKIKALLERTGYTLDV
TTGQRKYGGPPPDSVYSGVQPGIGTEVFVGKIPRDLYEDELVPLFEKAGPIWDLRLMMDPLSGQNRGYAF
ITFCGKEAAQEAVKLCDSYEIRPGKHLGVCISVANNRLFVGSIPKNKTKENILEEFSKVTEGLVDVILYH
QPDDKKKNRGFCFLEYEDHKSAAQARRRLMSGKVKVWGNVVTVEWADPVEEPDPEVMAKVKVLFVRNLAT
TVTEEILEKSFSEFGKLERVKKLKDYAFVHFEDRGAAVKAMDEMNGKEIEGEEIEIVLAKPPDKKRKERQ
AARQASRSTAYEDYYYHPPPRMPPPIRGRGRGGGRGGYGYPPDYYGYEDYYDDYYGYDYHDYRGGYEDPY
YGYDDGYAVRGRGGGRGGRGAPPPPRGRGAPPPRGRAGYSQRGAPLGPPRGSRGGRGGPAQQQRGRGSRG
SRGNRGGNVGGKRKADGYNQPDSKRRQTNNQQNWGSQPIAQQPLQQGGDYSGNYGYNNDNQEFYQDTYGQ
QWK

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_005826
ORF Size 1899 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_005826.5
RefSeq Size 2663 bp
RefSeq ORF 1902 bp
Locus ID 10236
UniProt ID O43390
Cytogenetics 1p36.12
Domains RRM
MW 70.8 kDa
Gene Summary This gene encodes an RNA-binding protein that is a member of the spliceosome C complex, which functions in pre-mRNA processing and transport. The encoded protein also promotes transcription at the c-fos gene. Alternative splicing results in multiple transcript variants. There are pseudogenes for this gene on chromosomes 4, 11, and 10. [provided by RefSeq, Jul 2014]

Other Versions

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.