PPP2R3B (NM_013239) Human Tagged ORF Clone

CAT#: RC222908

Reviews ()
Write a review

PPP2R3B (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B'', beta (PPP2R3B)



Reconstitution Protocol

USD 535.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "PPP2R3B"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PPP2R3B
Synonyms NYREN8; PPP2R3L; PPP2R3LY; PR48; PR70
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC222908 representing NM_013239
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCGCCCGGCAAAGTGCTGCAGCCGGTCCTGAAGATGAAGGTGGACGAGCTGTTCCTGTACTGGCTCA
GCGAGGCCAGCACGCAGCGGATGCTGCAGGACTGCCTGCGCCGGATCAAGGCGCCCGGGCGGGACCAGCC
GACCCCGGGGGACGGGGAGCAGCCCGGGGCCTGGCCCACAGCCCCGCTCGCCGCCCCCCGGCCCAGCGGG
CTCGAACCCCCGGGAACCCCCGGGCCGGGCCCTGCGCTGCCCCTGGGCGCCGCCTCCAGCCCCAGGAACG
CGCCCCACGTTCGAGGCACCCGTAGATCCGCAGGGACGAGAGTAGTTCAGACACGGAAAGAAGAGCCTCT
GCCCCCGGCCACGAGCCAAAGCATTCCGACCTTCTACTTCCCCAGAGGACGCCCGCAGGACTCCGTCAAC
GTGGATGCCGTCATCAGCAAGATCGAGAGCACCTTCGCCCGGTTCCCCCACGAGAGGGCCACCATGGATG
ACATGGGCCTGGTGGCCAAGGCCTGCGGCTGCCCCCTCTACTGGAAGGGGCCGCTCTTCTATGGCGCCGG
CGGGGAGCGCACGGGCTCCGTGTCCGTCCACAAGTTCGTCGCCATGTGGAGAAAAATCCTCCAGAACTGC
CACGACGACGCGGCCAAGTTCGTCCATCTGCTCATGAGCCCCGGCTGCAACTACCTGGTGCAGGAGGACT
TTGTCCCCTTCTTGCAGGACGTGGTGAACACGCACCCGGGGCTGTCGTTCCTGAAGGAGGCGTCCGAGTT
CCACTCGCGCTACATCACCACGGTCATCCAGCGGATCTTCTACGCCGTGAACCGGTCCTGGTCCGGCAGG
ATCACCTGCGCCGAGCTGCGGAGGAGCTCCTTCCTGCAGAATGTGGCGCTGCTGGAGGAGGAGGCGGACA
TCAACCAGCTGACCGAATTCTTCTCGTACGAGCATTTCTACGTCATCTACTGCAAGTTCTGGGAGCTGGA
CACGGACCACGACCTGCTCATCGACGCGGACGACCTGGCGCGGCACAATGACCACGCCCTTTCTACCAAG
ATGATAGACAGGATCTTCTCAGGAGCAGTCACACGAGGCAGAAAAGTGCAGAAGGAAGGGAAGATCAGCT
ATGCCGACTTTGTCTGGTTTTTGATCTCTGAGGAAGACAAAAAAACACCGACCAGCATCGAGTACTGGTT
CCGCTGCATGGACCTGGACGGGGACGGCGCCCTGTCCATGTTCGAGCTCGAGTACTTCTACGAGGAGCAG
TGCCGAAGGCTGGACAGCATGGCCATCGAGGCCCTGCCCTTCCAGGACTGCCTCTGCCAGATGCTGGACC
TGGTCAAGCCGAGGACTGAAGGGAAGATCACGCTGCAGGACCTGAAGCGCTGCAAGCTGGCYAACGTCTT
CTTCGACACCTTCTTCAACATCGAGAAGTACCTCGACCACGAGCAGAAAGAGCAGATCTCCCTGCTCAGG
GACGGTGACAGCGGCGGCCCCGAGCTCTCGGACTGGGAGAAGTACGCGGCCGAGGAGTACGACATCCTGG
TGGCCGAGGAGACYGYGGGAGAGCCCTGGGAGGACGGGTTCGAGGCCGAGCTCAGCCCYGTGGAGCAGAA
GCTGAGTGCGCTGCGCTCCCCGCTGGCCCAGAGGCCCTTCTTCGAGGCGCCCTCACCGCTGGGCGCCGTG
GACCTGTACGAGTACGCATGCGGGGACGAGGACCTGGAGCCGCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC222908 representing NM_013239
Red=Cloning site Green=Tags(s)

MPPGKVLQPVLKMKVDELFLYWLSEASTQRMLQDCLRRIKAPGRDQPTPGDGEQPGAWPTAPLAAPRPSG
LEPPGTPGPGPALPLGAASSPRNAPHVRGTRRSAGTRVVQTRKEEPLPPATSQSIPTFYFPRGRPQDSVN
VDAVISKIESTFARFPHERATMDDMGLVAKACGCPLYWKGPLFYGAGGERTGSVSVHKFVAMWRKILQNC
HDDAAKFVHLLMSPGCNYLVQEDFVPFLQDVVNTHPGLSFLKEASEFHSRYITTVIQRIFYAVNRSWSGR
ITCAELRRSSFLQNVALLEEEADINQLTEFFSYEHFYVIYCKFWELDTDHDLLIDADDLARHNDHALSTK
MIDRIFSGAVTRGRKVQKEGKISYADFVWFLISEEDKKTPTSIEYWFRCMDLDGDGALSMFELEYFYEEQ
CRRLDSMAIEALPFQDCLCQMLDLVKPRTEGKITLQDLKRCKLXNVFFDTFFNIEKYLDHEQKEQISLLR
DGDSGGPELSDWEKYAAEEYDILVAEEXXGEPWEDGFEAELSXVEQKLSALRSPLAQRPFFEAPSPLGAV
DLYEYACGDEDLEPL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_013239
ORF Size 1725 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_013239.5
RefSeq Size 2071 bp
RefSeq ORF 1728 bp
Locus ID 28227
UniProt ID Q9Y5P8
Cytogenetics X;Y
Protein Families Druggable Genome, Phosphatase
MW 64.9 kDa
Gene Summary Protein phosphatase 2 (formerly named type 2A) is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division. Protein phosphatase 2 holoenzymes are heterotrimeric proteins composed of a structural subunit A, a catalytic subunit C, and a regulatory subunit B. The regulatory subunit is encoded by a diverse set of genes that have been grouped into the B/PR55, B'/PR61, and B''/PR72 families. These different regulatory subunits confer distinct enzymatic specificities and intracellular localizations to the holozenzyme. The product of this gene belongs to the B'' family. The B'' family has been further divided into subfamilies. The product of this gene belongs to the beta subfamily of regulatory subunit B''. [provided by RefSeq, Apr 2010]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.