HTRA1 (NM_002775) Human Tagged ORF Clone

CAT#: RC222362

HTRA1 (Myc-DDK-tagged)-Human HtrA serine peptidase 1 (HTRA1)

Change vector?

USD 618.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name HTRA1 (NM_002775) Human Tagged ORF Clone
Symbol HTRA1
Synonyms ARMD7; CADASIL2; CARASIL; HtrA; L56; ORF480; PRSS11
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC222362 representing NM_002775
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGATCCCGCGCGCCGCTCTTCTCCCGCTGCTGCTGCTGCTGCTGGCGGCGCCCGCCTCGGCGCAGC
TGTCCCGGGCCGGCCGCTCGGCGCCTTTGGCTGCCGGTTGCCCAGACCGCTGCGAGCCGGCGCGCTGCCC
GCCGCAGCCGGAGCACTGCGAGGGCGGCCGGGCCCGGGACGCGTGCGGCTGCTGCGAGGTGTGCGGCGCG
CCCGAGGGCGCCGCGTGCGGCCTGCAGGAGGGCCCGTGCGGCGAGGGGCTGCAGTGCGTGGTGCCCTTCG
GGGTGCCAGCCTCGGCCACGGTGCGGCGGCGCGCGCAGGCCGGCCTCTGTGTGTGCGCCAGCAGCGAGCC
GGTGTGCGGCAGCGACGCCAACACCTACGCCAACCTGTGCCAGCTGCGCGCCGCCAGCCGCCGCTCCGAG
AGGCTGCACCGGCCGCCGGTCATCGTCCTGCAGCGCGGAGCCTGCGGCCAAGGGCAGGAAGATCCCAACA
GTTTGCGCCATAAATATAACTTTATCGCGGACGTGGTGGAGAAGATCGCCCCTGCCGTGGTTCATATCGA
ATTGTTTCGCAAGCTTCCGTTTTCTAAACGAGAGGTGCCGGTGGCTAGTGGGTCTGGGTTTATTGTGTCG
GAAGATGGACTGATCGTGACAAATGCCCACGTGGTGACCAACAAGCACCGGGTCAAAGTTGAGCTGAAGA
ACGGTGCCACTTACGAAGCCAAAATCAAGGATGTGGATGAGAAAGCAGACATCGCACTCATCAAAATTGA
CCACCAGGGCAAGCTGCCTGTCCTGCTGCTTGGCCGCTCCTCAGAGCTGCGGCCGGGAGAGTTCGTGGTC
GCCATCGGAAGCCCGTTTTCCCTTCAAAACACAGTCACCACCGGGATCGTGAGCACCACCCAGCGAGGCG
GCAAAGAGCTGGGGCTCCGCAACTCAGACATGGACTACATCCAGACCGACGCCATCATCAACTATGGAAA
CTCGGGAGGCCCGTTAGTAAACCTGGACGGTGAAGTGATTGGAATTAACACTTTGAAAGTGACAGCTGGA
ATCTCCTTTGCAATCCCATCTGATAAGATTAAAAAGTTCCTCACGGAGTCCCATGACCGACAGGCCAAAG
GAAAAGCCATCACCAAGAAGAAGTATATTGGTATCCGAATGATGTCACTCACGTCCAGCAAAGCCAAAGA
GCTGAAGGACCGGCACCGGGACTTCCCAGACGTGATCTCAGGAGCGTATATAATTGAAGTAATTCCTGAT
ACCCCAGCAGAAGCTGGTGGTCTCAAGGAAAACGACGTCATAATCAGCATCAATGGACAGTCCGTGGTCT
CCGCCAATGATGTCAGCGACGTCATTAAAAGGGAAAGCACCCTGAACATGGTGGTCCGCAGGGGTAATGA
AGATATCATGATCACAGTGATTCCCGAAGAAATTGACCCAAGCGGACCG


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC222362 representing NM_002775
Red=Cloning site Green=Tags(s)

MQIPRAALLPLLLLLLAAPASAQLSRAGRSAPLAAGCPDRCEPARCPPQPEHCEGGRARDACGCCEVCGA
PEGAACGLQEGPCGEGLQCVVPFGVPASATVRRRAQAGLCVCASSEPVCGSDANTYANLCQLRAASRRSE
RLHRPPVIVLQRGACGQGQEDPNSLRHKYNFIADVVEKIAPAVVHIELFRKLPFSKREVPVASGSGFIVS
EDGLIVTNAHVVTNKHRVKVELKNGATYEAKIKDVDEKADIALIKIDHQGKLPVLLLGRSSELRPGEFVV
AIGSPFSLQNTVTTGIVSTTQRGGKELGLRNSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAG
ISFAIPSDKIKKFLTESHDRQAKGKAITKKKYIGIRMMSLTSSKAKELKDRHRDFPDVISGAYIIEVIPD
TPAEAGGLKENDVIISINGQSVVSANDVSDVIKRESTLNMVVRRGNEDIMITVIPEEIDPSGP

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_002775
ORF Size 1449 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_002775.1, NM_002775.2, NM_002775.3, NM_002775.4, NP_002766
RefSeq Size 2133
Locus ID 5654
Cytogenetics 10q26.13
Domains IB, trypsin, PDZ, KAZAL
Protein Families Secreted Protein, Protease, Druggable Genome
MW 51.53 kDa
Gene Summary This gene encodes a member of the trypsin family of serine proteases. This protein is a secreted enzyme that is proposed to regulate the availability of insulin-like growth factors (IGFs) by cleaving IGF-binding proteins. It has also been suggested to be a regulator of cell growth. Variations in the promoter region of this gene are the cause of susceptibility to age-related macular degeneration type 7. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations