HTRA1 (NM_002775) Human Tagged ORF Clone

CAT#: RC222362

Reviews ()
Write a review

HTRA1 (Myc-DDK-tagged)-Human HtrA serine peptidase 1 (HTRA1)



Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 457.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol HTRA1
Synonyms ARMD7; CADASIL2; CARASIL; HtrA; L56; ORF480; PRSS11
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC222362 representing NM_002775.
Blue=ORF Red=Cloning site Green=Tag(s)

GCGATCGCC
ATGCAGATCCCGCGCGCCGCTCTTCTCCCGCTGCTGCTGCTGCTGCTGGCGGCGCCCGCCTCGGCGCAG
CTGTCCCGGGCCGGCCGCTCGGCGCCTTTGGCTGCCGGTTGCCCAGACCGCTGCGAGCCGGCGCGCTGC
CCGCCGCAGCCGGAGCACTGCGAGGGCGGCCGGGCCCGGGACGCGTGCGGCTGCTGCGAGGTGTGCGGC
GCGCCCGAGGGCGCCGCGTGCGGCCTGCAGGAGGGCCCGTGCGGCGAGGGGCTGCAGTGCGTGGTGCCC
TTCGGGGTGCCAGCCTCGGCCACGGTGCGGCGGCGCGCGCAGGCCGGCCTCTGTGTGTGCGCCAGCAGC
GAGCCGGTGTGCGGCAGCGACGCCAACACCTACGCCAACCTGTGCCAGCTGCGCGCCGCCAGCCGCCGC
TCCGAGAGGCTGCACCGGCCGCCGGTCATCGTCCTGCAGCGCGGAGCCTGCGGCCAAGGGCAGGAAGAT
CCCAACAGTTTGCGCCATAAATATAACTTTATCGCGGACGTGGTGGAGAAGATCGCCCCTGCCGTGGTT
CATATCGAATTGTTTCGCAAGCTTCCGTTTTCTAAACGAGAGGTGCCGGTGGCTAGTGGGTCTGGGTTT
ATTGTGTCGGAAGATGGACTGATCGTGACAAATGCCCACGTGGTGACCAACAAGCACCGGGTCAAAGTT
GAGCTGAAGAACGGTGCCACTTACGAAGCCAAAATCAAGGATGTGGATGAGAAAGCAGACATCGCACTC
ATCAAAATTGACCACCAGGGCAAGCTGCCTGTCCTGCTGCTTGGCCGCTCCTCAGAGCTGCGGCCGGGA
GAGTTCGTGGTCGCCATCGGAAGCCCGTTTTCCCTTCAAAACACAGTCACCACCGGGATCGTGAGCACC
ACCCAGCGAGGCGGCAAAGAGCTGGGGCTCCGCAACTCAGACATGGACTACATCCAGACCGACGCCATC
ATCAACTATGGAAACTCGGGAGGCCCGTTAGTAAACCTGGACGGTGAAGTGATTGGAATTAACACTTTG
AAAGTGACAGCTGGAATCTCCTTTGCAATCCCATCTGATAAGATTAAAAAGTTCCTCACGGAGTCCCAT
GACCGACAGGCCAAAGGAAAAGCCATCACCAAGAAGAAGTATATTGGTATCCGAATGATGTCACTCACG
TCCAGCAAAGCCAAAGAGCTGAAGGACCGGCACCGGGACTTCCCAGACGTGATCTCAGGAGCGTATATA
ATTGAAGTAATTCCTGATACCCCAGCAGAAGCTGGTGGTCTCAAGGAAAACGACGTCATAATCAGCATC
AATGGACAGTCCGTGGTCTCCGCCAATGATGTCAGCGACGTCATTAAAAGGGAAAGCACCCTGAACATG
GTGGTCCGCAGGGGTAATGAAGATATCATGATCACAGTGATTCCCGAAGAAATTGACCCA


>Peptide sequence encoded by RC222362
Blue=ORF Red=Cloning site Green=Tag(s)

MQIPRAALLPLLLLLLAAPASAQLSRAGRSAPLAAGCPDRCEPARCPPQPEHCEGGRARDACGCCEVCG
APEGAACGLQEGPCGEGLQCVVPFGVPASATVRRRAQAGLCVCASSEPVCGSDANTYANLCQLRAASRR
SERLHRPPVIVLQRGACGQGQEDPNSLRHKYNFIADVVEKIAPAVVHIELFRKLPFSKREVPVASGSGF
IVSEDGLIVTNAHVVTNKHRVKVELKNGATYEAKIKDVDEKADIALIKIDHQGKLPVLLLGRSSELRPG
EFVVAIGSPFSLQNTVTTGIVSTTQRGGKELGLRNSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTL
KVTAGISFAIPSDKIKKFLTESHDRQAKGKAITKKKYIGIRMMSLTSSKAKELKDRHRDFPDVISGAYI
IEVIPDTPAEAGGLKENDVIISINGQSVVSANDVSDVIKRESTLNMVVRRGNEDIMITVIPEEIDP



Recombinant protein using RC222362 also available, TP322362
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-RsrI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_002775
ORF Size 1440 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq Size 2133 bp
RefSeq ORF 1443 bp
Locus ID 5654
UniProt ID Q92743
Cytogenetics 10q26.13
Domains IB, Tryp_SPc, PDZ, kazal
Protein Families Druggable Genome, Protease, Secreted Protein
MW 51.3 kDa
Gene Summary This gene encodes a member of the trypsin family of serine proteases. This protein is a secreted enzyme that is proposed to regulate the availability of insulin-like growth factors (IGFs) by cleaving IGF-binding proteins. It has also been suggested to be a regulator of cell growth. Variations in the promoter region of this gene are the cause of susceptibility to age-related macular degeneration type 7. [provided by RefSeq, Jul 2008]
Other products for "HTRA1"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.