LIM Kinase 1 (LIMK1) (NM_002314) Human Tagged ORF Clone

CAT#: RC218058

Reviews ()
Write a review

LIMK1 (Myc-DDK-tagged)-Human LIM domain kinase 1 (LIMK1), transcript variant 1



  "NM_002314" in other vectors (6)

Reconstitution Protocol

USD 602.00

In Stock*

Size
    • 10 ug

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "LIMK1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol LIMK1
Synonyms LIMK; LIMK-1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC218058 representing NM_002314
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGGTTGACGCTACTTTGTTGCACCTGGAGGGAAGAACGTATGGGAGAGGAAGGAAGCGAGTTGCCCG
TGTGTGCAAGCTGCGGCCAGAGGATCTATGATGGCCAGTACCTCCAGGCCCTGAACGCGGACTGGCACGC
AGACTGCTTCAGGTGTTGTGACTGCAGTGCCTCCCTGTCGCACCAGTACTATGAGAAGGATGGGCAGCTC
TTCTGCAAGAAGGACTACTGGGCCCGCTATGGCGAGTCCTGCCATGGGTGCTCTGAGCAAATCACCAAGG
GACTGGTTATGGTGGCTGGGGAGCTGAAGTACCACCCCGAGTGTTTCATCTGCCTCACGTGTGGGACCTT
TATCGGTGACGGGGACACCTACACGCTGGTGGAGCACTCCAAGCTGTACTGCGGGCACTGCTACTACCAG
ACTGTGGTGACCCCCGTCATCGAGCAGATCCTGCCTGACTCCCCTGGCTCCCACCTGCCCCACACCGTCA
CCCTGGTGTCCATCCCAGCCTCATCTCATGGCAAGCGTGGACTTTCAGTCTCCATTGACCCCCCGCACGG
CCCACCGGGCTGTGGCACCGAGCACTCACACACCGTCCGCGTCCAGGGAGTGGATCCGGGCTGCATGAGC
CCAGATGTGAAGAATTCCATCCACGTCGGAGACCGGATCTTGGAAATCAATGGCACGCCCATCCGAAATG
TGCCCCTGGACGAGATTGACCTGCTGATTCAGGAAACCAGCCGCCTGCTCCAGCTGACCCTCGAGCATGA
CCCTCACGATACACTGGGCCACGGGCTGGGGCCTGAGACCAGCCCCCTGAGCTCTCCGGCTTATACTCCC
AGCGGGGAGGCGGGCAGCTCTGCCCGGCAGAAACCTGTCTTGAGGAGCTGCAGCATCGACAGGTCTCCGG
GCGCTGGCTCACTGGGCTCCCCGGCCTCCCAGCGCAAGGACCTGGGTCGCTCTGAGTCCCTCCGCGTAGT
CTGCCGGCCACACCGCATCTTCCGGCCGTCGGACCTCATCCACGGGGAGGTGCTGGGCAAGGGCTGCTTC
GGCCAGGCTATCAAGGTGACACACCGTGAGACAGGTGAGGTGATGGTGATGAAGGAGCTGATCCGGTTCG
ACGAGGAGACCCAGAGGACGTTCCTCAAGGAGGTGAAGGTCATGCGATGCCTGGAACACCCCAACGTGCT
CAAGTTCATCGGGGTGCTCTACAAGGACAAGAGGCTCAACTTCATCACTGAGTACATCAAGGGCGGCACG
CTCCGGGGCATCATCAAGAGCATGGACAGCCAGTACCCATGGAGCCAGAGAGTGAGCTTTGCCAAGGACA
TCGCATCAGGGATGGCCTACCTCCACTCCATGAACATCATCCACCGAGACCTCAACTCCCACAACTGCCT
GGTCCGCGAGAACAAGAATGTGGTGGTGGCTGACTTCGGGCTGGCGCGTCTCATGGTGGACGAGAAGACT
CAGCCTGAGGGCCTGCGGAGCCTCAAGAAGCCAGACCGCAAGAAGCGCTACACCGTGGTGGGCAACCCCT
ACTGGATGGCACCTGAGATGATCAACGGCCGCAGCTATGATGAGAAGGTGGATGTGTTCTCCTTTGGGAT
CGTCCTGTGCGAGATCATCGGGCGGGTGAACGCAGACCCTGACTACCTGCCCCGCACCATGGACTTTGGC
CTCAACGTGCGAGGATTCCTGGACCGCTACTGCCCCCCAAACTGCCCCCCGAGCTTCTTTCCCATCACCG
TGCGCTGTTGCGATCTGGACCCCGAGAAGAGGCCATCCTTTGTGAAGCTGGAACACTGGCTGGAGACCCT
CCGCATGCACCTGGCCGGCCACCTGCCACTGGGCCCACAGCTGGAGCAGCTGGACAGAGGTTTCTGGGAG
ACCTACCGGCGCGGCGAGAGCGGACTGCCTGCCCACCCTGAGGTCCCCGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC218058 representing NM_002314
Red=Cloning site Green=Tags(s)

MRLTLLCCTWREERMGEEGSELPVCASCGQRIYDGQYLQALNADWHADCFRCCDCSASLSHQYYEKDGQL
FCKKDYWARYGESCHGCSEQITKGLVMVAGELKYHPECFICLTCGTFIGDGDTYTLVEHSKLYCGHCYYQ
TVVTPVIEQILPDSPGSHLPHTVTLVSIPASSHGKRGLSVSIDPPHGPPGCGTEHSHTVRVQGVDPGCMS
PDVKNSIHVGDRILEINGTPIRNVPLDEIDLLIQETSRLLQLTLEHDPHDTLGHGLGPETSPLSSPAYTP
SGEAGSSARQKPVLRSCSIDRSPGAGSLGSPASQRKDLGRSESLRVVCRPHRIFRPSDLIHGEVLGKGCF
GQAIKVTHRETGEVMVMKELIRFDEETQRTFLKEVKVMRCLEHPNVLKFIGVLYKDKRLNFITEYIKGGT
LRGIIKSMDSQYPWSQRVSFAKDIASGMAYLHSMNIIHRDLNSHNCLVRENKNVVVADFGLARLMVDEKT
QPEGLRSLKKPDRKKRYTVVGNPYWMAPEMINGRSYDEKVDVFSFGIVLCEIIGRVNADPDYLPRTMDFG
LNVRGFLDRYCPPNCPPSFFPITVRCCDLDPEKRPSFVKLEHWLETLRMHLAGHLPLGPQLEQLDRGFWE
TYRRGESGLPAHPEVPD

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_002314
ORF Size 1941 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_002314.4
RefSeq Size 3332 bp
RefSeq ORF 1944 bp
Locus ID 3984
UniProt ID P53667
Cytogenetics 7q11.23
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Axon guidance, Fc gamma R-mediated phagocytosis, Regulation of actin cytoskeleton
MW 72.4 kDa
Gene Summary There are approximately 40 known eukaryotic LIM proteins, so named for the LIM domains they contain. LIM domains are highly conserved cysteine-rich structures containing 2 zinc fingers. Although zinc fingers usually function by binding to DNA or RNA, the LIM motif probably mediates protein-protein interactions. LIM kinase-1 and LIM kinase-2 belong to a small subfamily with a unique combination of 2 N-terminal LIM motifs and a C-terminal protein kinase domain. LIMK1 is a serine/threonine kinase that regulates actin polymerization via phosphorylation and inactivation of the actin binding factor cofilin. This protein is ubiquitously expressed during development and plays a role in many cellular processes associated with cytoskeletal structure. This protein also stimulates axon growth and may play a role in brain development. LIMK1 hemizygosity is implicated in the impaired visuospatial constructive cognition of Williams syndrome. Alternative splicing results in multiple transcript variants encoding distinct isoforms.[provided by RefSeq, Feb 2011]

Other Versions

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.