AFF4 (NM_014423) Human Tagged ORF Clone

CAT#: RC217692

AFF4 (Myc-DDK-tagged)-Human AF4/FMR2 family, member 4 (AFF4)

Clone Modification / Custom Cloning Service

USD 824.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name AFF4 (NM_014423) Human Tagged ORF Clone
Symbol AFF4
Synonyms AF5Q31; MCEF
Vector pCMV6-Entry
Sequence Data
>RC217692 representing NM_014423
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACCGTGAAGACCGGAATGTGCTGCGTATGAAAGAACGGGAAAGGCGGAATCAGGAAATTCAGCAGG
GCGAAGACGCCTTCCCACCTAGCTCTCCTCTCTTTGCAGAGCCATACAAAGTTACTAGCAAAGAAGATAA
GTTATCAAGTCGTATTCAGAGTATGCTTGGAAACTACGATGAAATGAAGGATTTCATAGGAGACAGATCT
ATACCAAAGCTTGTTGCAATTCCCAAGCCTACAGTACCACCATCAGCAGATGAAAAATCTAACCCAAATT
TCTTTGAACAGAGACATGGAGGCTCTCATCAGAGTAGCAAATGGACTCCAGTAGGACCCGCACCCAGCAC
TTCTCAGTCTCAGAAACGGTCCTCAGGCTTACAGAGTGGACATAGTAGCCAGCGGACCAGCGCAGGTAGC
AGTAGTGGCACTAACAGTAGTGGTCAGAGGCACGACCGTGAGTCATATAACAATAGTGGGAGCAGTAGCC
GGAAAAAAGGCCAGCATGGATCAGAACACTCCAAATCACGTTCTTCCAGCCCTGGAAAACCCCAGGCTGT
TTCTTCATTAAACTCTAGTCATTCCAGGTCTCATGGGAATGATCACCATAGCAAGGAACATCAACGCTCC
AAATCACCTCGGGACCCTGATGCAAACTGGGATTCTCCTTCCCGTGTACCTTTTTCAAGTGGGCAGCACT
CAACTCAATCTTTCCCACCCTCATTGATGTCAAAGTCCAATTCAATGTTACAGAAACCCACTGCCTATGT
GCGGCCCATGGACGGACAGGAGTCCATGGAACCAAAGCTGTCCTCTGAGCACTACAGCAGCCAATCCCAT
GGCAACAGCATGACTGAGCTGAAGCCCAGCAGCAAAGCACATCTCACCAAGCTGAAAATACCTTCCCAAC
CACTGGATGCATCAGCTTCTGGTGATGTGAGCTGTGTGGATGAAATCCTAAAAGAGATGACGCATTCATG
GCCTCCCCCTCTAACGGCTATTCATACACCATGCAAAACAGAACCTTCCAAATTTCCTTTTCCAACTAAG
GAGTCTCAGCAGTCCAATTTTGGCACTGGAGAACAAAAAAGATATAATCCTTCTAAAACTTCAAATGGGC
ACCAGTCTAAATCTATGTTAAAAGATGACTTAAAACTAAGCAGCAGTGAAGACAGTGATGGGGAACAGGA
TTGTGATAAGACAATGCCGAGGAGTACACCAGGAAGTAACTCTGAACCTTCACACCATAATAGTGAAGGA
GCAGATAACTCCAGGGATGATTCTAGTAGCCACAGTGGATCTGAAAGCAGCTCTGGATCTGACTCAGAGA
GTGAAAGTAGTTCCAGTGACAGTGAGGCAAATGAGCCATCCCAGAGTGCATCTCCCGAGCCTGAACCCCC
GCCAACAAACAAATGGCAACTTGATAATTGGCTGAATAAAGTGAACCCACATAAAGTGTCACCCGCCTCT
TCAGTGGACAGTAACATCCCATCATCTCAAGGCTACAAAAAGGAAGGCCGAGAGCAGGGCACTGGGAATA
GCTACACTGATACAAGTGGACCTAAAGAAACGAGTTCCGCTACTCCGGGACGAGACTCCAAAACCATCCA
AAAGGGATCAGAAAGTGGGCGTGGGAGGCAGAAATCTCCTGCACAGAGTGACAGCACAACACAGAGAAGA
ACTGTAGGCAAAAAACAACCCAAAAAGGCTGAGAAGGCAGCTGCTGAAGAGCCTCGTGGAGGCCTGAAGA
TAGAAAGTGAAACCCCTGTAGACTTGGCTAGCAGCATGCCCTCCAGCAGACACAAAGCAGCCACCAAAGG
CTCAAGGAAACCCAATATAAAGAAGGAGTCTAAGTCTTCCCCTCGACCTACAGCAGAGAAAAAGAAATAT
AAGTCAACAAGTAAATCTTCCCAGAAATCAAGGGAAATCATAGAAACAGATACCTCATCCTCAGATTCAG
ATGAAAGTGAGAGCCTTCCTCCTTCCTCACAAACTCCTAAGTACCCCGAGAGCAATAGGACTCCTGTTAA
ACCCTCCTCAGTGGAGGAAGAAGATAGCTTTTTTCGGCAACGAATGTTCTCTCCTATGGAAGAGAAGGAA
CTTCTTTCACCCCTCAGTGAGCCTGATGACAGGTACCCACTTATTGTGAAGATTGACCTGAATCTTTTGA
CTAGAATACCAGGAAAGCCTTACAAAGAAACAGAGCCGCCCAAGGGGGAAAAGAAAAATGTGCCAGAAAA
GCACACGAGAGAGGCTCAGAAACAAGCCTCAGAAAAAGTTTCCAACAAAGGCAAGAGGAAGCATAAGAAT
GAAGATGATAACCGAGCCAGTGAGAGCAAGAAACCCAAAACGGAGGACAAGAATTCAGCAGGCCATAAGC
CATCCAGCAACAGAGAGTCATCTAAGCAGAGTGCTGCAAAAGAAAAGGATTTGTTGCCTTCTCCCGCTGG
GCCTGTTCCTTCAAAAGATCCAAAAACAGAGCATGGCTCTCGGAAGAGGACTATTAGTCAGTCTTCTTCC
TTAAAGTCAAGCAGTAACAGCAACAAGGAGACGAGTGGCAGCAGCAAAAACAGTTCCTCCACATCAAAGC
AGAAGAAGACCGAAGGGAAGACTTCCAGTAGCTCCAAGGAGGTTAAGGAAAAGGCTCCAAGTAGCTCCTC
TAACTGTCCTCCATCTGCACCAACTCTTGATTCTTCTAAGCCTCGGAGAACAAAGCTTGTCTTTGATGAC
AGAAATTATTCAGCAGACCATTATTTACAAGAAGCAAAAAAGCTAAAGCACAATGCAGATGCATTGTCTG
ATAGGTTTGAGAAAGCTGTATACTATCTTGATGCTGTGGTATCTTTCATTGAATGTGGGAATGCATTAGA
GAAGAATGCTCAGGAATCCAAATCCCCATTCCCTATGTATTCAGAGACGGTGGATCTCATCAAATACACT
ATGAAGCTAAAGAATTACTTGGCACCAGATGCTACAGCTGCAGATAAACGACTCACAGTACTTTGCCTGC
GATGCGAGTCTTTGCTGTACCTGAGGCTGTTCAAACTGAAGAAGGAAAATGCTCTGAAGTACTCAAAGAC
ACTGACAGAGCACCTGAAGAATTCTTATAATAATTCTCAAGCACCATCGCCTGGCTTGGGAAGCAAAGCT
GTGGGGATGCCTTCCCCTGTTTCTCCAAAGCTGTCACCAGGCAATTCAGGAAATTATTCATCTGGGGCCA
GTAGTGCTTCTGCAAGTGGTTCTTCAGTGACCATTCCACAGAAGATCCACCAGATGGCAGCCAGCTATGT
TCAGGTCACATCCAACTTCCTCTATGCCACCGAAATTTGGGACCAAGCTGAACAGCTTTCCAAAGAGCAA
AAAGAATTCTTTGCTGAACTGGATAAAGTAATGGGCCCTCTCATCTTTAATGCAAGCATCATGACAGATC
TAGTTCGTTATACCCGGCAGGGACTGCACTGGCTTCGCCAGGATGCCAAGTTGATATCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC217692 representing NM_014423
Red=Cloning site Green=Tags(s)

MNREDRNVLRMKERERRNQEIQQGEDAFPPSSPLFAEPYKVTSKEDKLSSRIQSMLGNYDEMKDFIGDRS
IPKLVAIPKPTVPPSADEKSNPNFFEQRHGGSHQSSKWTPVGPAPSTSQSQKRSSGLQSGHSSQRTSAGS
SSGTNSSGQRHDRESYNNSGSSSRKKGQHGSEHSKSRSSSPGKPQAVSSLNSSHSRSHGNDHHSKEHQRS
KSPRDPDANWDSPSRVPFSSGQHSTQSFPPSLMSKSNSMLQKPTAYVRPMDGQESMEPKLSSEHYSSQSH
GNSMTELKPSSKAHLTKLKIPSQPLDASASGDVSCVDEILKEMTHSWPPPLTAIHTPCKTEPSKFPFPTK
ESQQSNFGTGEQKRYNPSKTSNGHQSKSMLKDDLKLSSSEDSDGEQDCDKTMPRSTPGSNSEPSHHNSEG
ADNSRDDSSSHSGSESSSGSDSESESSSSDSEANEPSQSASPEPEPPPTNKWQLDNWLNKVNPHKVSPAS
SVDSNIPSSQGYKKEGREQGTGNSYTDTSGPKETSSATPGRDSKTIQKGSESGRGRQKSPAQSDSTTQRR
TVGKKQPKKAEKAAAEEPRGGLKIESETPVDLASSMPSSRHKAATKGSRKPNIKKESKSSPRPTAEKKKY
KSTSKSSQKSREIIETDTSSSDSDESESLPPSSQTPKYPESNRTPVKPSSVEEEDSFFRQRMFSPMEEKE
LLSPLSEPDDRYPLIVKIDLNLLTRIPGKPYKETEPPKGEKKNVPEKHTREAQKQASEKVSNKGKRKHKN
EDDNRASESKKPKTEDKNSAGHKPSSNRESSKQSAAKEKDLLPSPAGPVPSKDPKTEHGSRKRTISQSSS
LKSSSNSNKETSGSSKNSSSTSKQKKTEGKTSSSSKEVKEKAPSSSSNCPPSAPTLDSSKPRRTKLVFDD
RNYSADHYLQEAKKLKHNADALSDRFEKAVYYLDAVVSFIECGNALEKNAQESKSPFPMYSETVDLIKYT
MKLKNYLAPDATAADKRLTVLCLRCESLLYLRLFKLKKENALKYSKTLTEHLKNSYNNSQAPSPGLGSKA
VGMPSPVSPKLSPGNSGNYSSGASSASASGSSVTIPQKIHQMAASYVQVTSNFLYATEIWDQAEQLSKEQ
KEFFAELDKVMGPLIFNASIMTDLVRYTRQGLHWLRQDAKLIS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_014423
ORF Size 3489 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_014423.1, NM_014423.2, NM_014423.3, NP_055238
RefSeq Size 9528
RefSeq ORF 3492
Locus ID 27125
Cytogenetics 5q31.1
Domains AF-4
Protein Families Transcription Factors
MW 127.3 kDa
Gene Summary The protein encoded by this gene belongs to the AF4 family of transcription factors involved in leukemia. It is a component of the positive transcription elongation factor b (P-TEFb) complex. A chromosomal translocation involving this gene and MLL gene on chromosome 11 is found in infant acute lymphoblastic leukemia with ins(5;11)(q31;q31q23). [provided by RefSeq, Oct 2011]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)