CBX2 (NM_032647) Human Tagged ORF Clone

CAT#: RC216313

CBX2 (Myc-DDK-tagged)-Human chromobox homolog 2 (CBX2), transcript variant 2

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro

AAV Particle: DDK


  "NM_032647" in other vectors (6)

Reconstitution Protocol

Get a free Anti-DDK antibody sample free with this product. Use code: "DDK-Clone". View details »

USD 300.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


Rabbit Polyclonal Anti-CBX2
    • 100 ul

USD 539.00

Other products for "CBX2"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol CBX2
Synonyms CDCA6; M33; SRXY5
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC216313 representing NM_032647
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGAGCTGAGCAGCGTGGGCGAGCAGGTCTTCGCCGCCGAGTGCATCCTGAGCAAGCGGCTCCGCA
AGGGCAAGCTGGAGTACCTGGTCAAGTGGCGCGGCTGGTCCTCCAAACATAACAGCTGGGAGCCGGAGGA
GAACATCCTGGACCCGAGGCTGCTCCTGGCCTTCCAGAAGAAGGAACATGAGAAGGAGGTGCAGAACCGG
AAGAGAGGCAAGAGGCCGAGAGGCCGGCCAAGGAAGCTCACTGCCATGTCCTCCTGCAGCCGGCGCTCCA
AGCTCAAGGTGGGTGGCTGCGCTGGGTATGCTGACCCCACCTCCCAGCACCCCCTTGGCGTAGGGGGCAG
GCAGAGGGAGGGTTTGGGGCCCTCAGGAAGGGGGTGGCACTTCTGCCAACAGTCTGTCCCTCTACTCGGA
AAACAGGAGCCCCCTTTCTTCCTGTCTCTCAGCTTCTGCTGCCAGGGGCCCCAGCCGGCTGAGAGTTCCT
CCCCGCCCCTCCCAGGGGCTTCCTGCTTCAGCCTGTCCTGCACGCCTCTCTGCTGGGTGGCAGGGTCAAA
CTGCTGCAGACAAGCACTCTTCCCTCCCAGGGGGTCCTTGGGGGACGGAAAGGAACAGGAAGCATGCGTA
CAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC216313 representing NM_032647
Red=Cloning site Green=Tags(s)

MEELSSVGEQVFAAECILSKRLRKGKLEYLVKWRGWSSKHNSWEPEENILDPRLLLAFQKKEHEKEVQNR
KRGKRPRGRPRKLTAMSSCSRRSKLKVGGCAGYADPTSQHPLGVGGRQREGLGPSGRGWHFCQQSVPLLG
KQEPPFFLSLSFCCQGPQPAESSSPPLPGASCFSLSCTPLCWVAGSNCCRQALFPPRGSLGDGKEQEACV
Q

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_032647
ORF Size 633 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_032647.3
RefSeq Size 1061 bp
RefSeq ORF 636 bp
Locus ID 84733
UniProt ID Q14781
Cytogenetics 17q25.3
Protein Families Transcription Factors
MW 23.1 kDa
Gene Summary This gene encodes a component of the polycomb multiprotein complex, which is required to maintain the transcriptionally repressive state of many genes throughout development via chromatin remodeling and modification of histones. Disruption of this gene in mice results in male-to-female gonadal sex reversal. Mutations in this gene are also associated with gonadal dysgenesis in humans. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.[provided by RefSeq, Mar 2010]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.