MDA5 (IFIH1) (NM_022168) Human Tagged ORF Clone

CAT#: RC215661

Reviews ()
Write a review

IFIH1 (Myc-DDK-tagged)-Human interferon induced with helicase C domain 1 (IFIH1)



  "NM_022168" in other vectors (6)

Special Offer: 20% off on control vector. Use code "Shuttle20".

USD 680.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol IFIH1
Synonyms AGS7; Hlcd; IDDM19; MDA-5; MDA5; RLR-2; SGMRT1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC215661 representing NM_022168
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGAATGGGTATTCCACAGACGAGAATTTCCGCTATCTCATCTCGTGCTTCAGGGCCAGGGTGAAAA
TGTACATCCAGGTGGAGCCTGTGCTGGACTACCTGACCTTTCTGCCTGCAGAGGTGAAGGAGCAGATTCA
GAGGACAGTCGCCACCTCCGGGAACATGCAGGCAGTTGAACTGCTGCTGAGCACCTTGGAGAAGGGAGTC
TGGCACCTTGGTTGGACTCGGGAATTCGTGGAGGCCCTCCGGAGAACCGGCAGCCCTCTGGCCGCCCGCT
ACATGAACCCTGAGCTCACGGACTTGCCCTCTCCATCGTTTGAGAACGCTCATGATGAATATCTCCAACT
GCTGAACCTCCTTCAGCCCACTCTGGTGGACAAGCTTCTAGTTAGAGACGTCTTGGATAAGTGCATGGAG
GAGGAACTGTTGACAATTGAAGACAGAAACCGGATTGCTGCTGCAGAAAACAATGGAAATGAATCAGGTG
TAAGAGAGCTACTAAAAAGGATTGTGCAGAAAGAAAACTGGTTCTCTGCATTTCTGAATGTTCTTCGTCA
AACAGGAAACAATGAACTTGTCCAAGAGTTAACAGGCTCTGATTGCTCAGAAAGCAATGCAGAGATTGAG
AATTTATCACAAGTTGATGGTCCTCAAGTGGAAGAGCAACTTCTTTCAACCACAGTTCAGCCAAATCTGG
AGAAGGAGGTCTGGGGCATGGAGAATAACTCATCAGAATCATCTTTTGCAGATTCTTCTGTAGTTTCAGA
ATCAGACACAAGTTTGGCAGAAGGAAGTGTCAGCTGCTTAGATGAAAGTCTTGGACATAACAGCAACATG
GGCAGTGATTCAGGCACCATGGGAAGTGATTCAGATGAAGAGAATGTGGCAGCAAGAGCATCCCCGGAGC
CAGAACTCCAGCTCAGGCCTTACCAAATGGAAGTTGCCCAGCCAGCCTTGGAAGGGAAGAATATCATCAT
CTGCCTCCCTACAGGGAGTGGAAAAACCAGAGTGGCTGTTTACATTGCCAAGGATCACTTAGACAAGAAG
AAAAAAGCATCTGAGCCTGGAAAAGTTATAGTTCTTGTCAATAAGGTACTGCTAGTTGAACAGCTCTTCC
GCAAGGAGTTCCAACCATTTTTGAAGAAATGGTATCGTGTTATTGGATTAAGTGGTGATACCCAACTGAA
AATATCATTTCCAGAAGTTGTCAAGTCCTGTGATATTATTATCAGTACAGCTCAAATCCTTGAAAACTCC
CTCTTAAACTTGGAAAATGGAGAAGATGCTGGTGTTCAATTGTCAGACTTTTCCCTCATTATCATTGATG
AATGTCATCACACCAACAAAGAAGCAGTGTATAATAACATCATGAGGCATTATTTGATGCAGAAGTTGAA
AAACAATAGACTCAAGAAAGAAAACAAACCAGTGATTCCCCTTCCTCAGATACTGGGACTAACAGCTTCA
CCTGGTGTTGGAGGGGCCACGAAGCAAGCCAAAGCTGAAGAACACATTTTAAAACTATGTGCCAATCTTG
ATGCATTTACTATTAAAACTGTTAAAGAAAACCTTGATCAACTGAAAAACCAAATACAGGAGCCATGCAA
GAAGTTTGCCATTGCAGATGCAACCAGAGAAGATCCATTTAAAGAGAAACTTCTAGAAATAATGACAAGG
ATTCAAACTTATTGTCAAATGAGTCCAATGTCAGATTTTGGAACTCAACCCTATGAACAATGGGCCATTC
AAATGGAAAAAAAAGCTGCAAAAGAAGGAAATCGCAAAGAACGTGTTTGTGCAGAACATTTGAGGAAGTA
CAATGAGGCCCTACAAATTAATGACACAATTCGAATGATAGATGCGTATACTCATCTTGAAACTTTCTAT
AATGAAGAGAAAGATAAGAAGTTTGCAGTCATAGAAGATGATAGTGATGAGGGTGGTGATGATGAGTATT
GTGATGGTGATGAAGATGAGGATGATTTAAAGAAACCTTTGAAACTGGATGAAACAGATAGATTTCTCAT
GACTTTATTTTTTGAAAACAATAAAATGTTGAAAAGGCTGGCTGAAAACCCAGAATATGAAAATGAAAAG
CTGACCAAATTAAGAAATACCATAATGGAGCAATATACTAGGACTGAGGAATCAGCACGAGGAATAATCT
TTACAAAAACACGACAGAGTGCATATGCGCTTTCCCAGTGGATTACTGAAAATGAAAAATTTGCTGAAGT
AGGAGTCAAAGCCCACCATCTGATTGGAGCTGGACACAGCAGTGAGTTCAAACCCATGACACAGAATGAA
CAAAAAGAAGTCATTAGTAAATTTCGCACTGGAAAAATAAATCTGCTTATCGCTACCACAGTGGCAGAAG
AAGGTCTGGATATTAAAGAATGTAACATTGTTATCCGTTATGGTCTCGTCACCAATGAAATAGCCATGGT
CCAGGCCCGTGGTCGAGCCAGAGCTGATGAGAGCACCTACGTCCTGGTTGCTCACAGTGGTTCAGGAGTT
ATCGAACGTGAGACAGTTAATGATTTCCGAGAGAAGATGATGTATAAAGCTATACATTGTGTTCAAAATA
TGAAACCAGAGGAGTATGCTCATAAGATTTTGGAATTACAGATGCAAAGTATAATGGAAAAGAAAATGAA
AACCAAGAGAAATATTGCCAAGCATTACAAGAATAACCTATCACTAATAACTTTCCTTTGCAAAAACTGC
AGTGTGCTAGCCTGTTCTGGGGAAGATATCCATGTAATTGAGAAAATGCATCACGTCAATATGACCCCAG
AATTCAAGGAACTTTACATTGTAAGAGAAAACAAAACACTGCAAAAGAAGTGTGCCGACTATCAAATAAA
TGGTGAAATCATCTGCAAATGTGGCCAGGCTTGGGGAACAATGATGGTGCACAAAGGCTTAGATTTGCCT
TGTCTCAAAATAAGGAATTTTGTAGTGGTTTTCAAAAATAATTCAACAAAGAAACAATACAAAAAGTGGG
TAGAATTACCTATCACATTTCCCAATCTTGACTATTCAGAATGCTGTTTATTTAGTGATGAGGAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC215661 representing NM_022168
Red=Cloning site Green=Tags(s)

MSNGYSTDENFRYLISCFRARVKMYIQVEPVLDYLTFLPAEVKEQIQRTVATSGNMQAVELLLSTLEKGV
WHLGWTREFVEALRRTGSPLAARYMNPELTDLPSPSFENAHDEYLQLLNLLQPTLVDKLLVRDVLDKCME
EELLTIEDRNRIAAAENNGNESGVRELLKRIVQKENWFSAFLNVLRQTGNNELVQELTGSDCSESNAEIE
NLSQVDGPQVEEQLLSTTVQPNLEKEVWGMENNSSESSFADSSVVSESDTSLAEGSVSCLDESLGHNSNM
GSDSGTMGSDSDEENVAARASPEPELQLRPYQMEVAQPALEGKNIIICLPTGSGKTRVAVYIAKDHLDKK
KKASEPGKVIVLVNKVLLVEQLFRKEFQPFLKKWYRVIGLSGDTQLKISFPEVVKSCDIIISTAQILENS
LLNLENGEDAGVQLSDFSLIIIDECHHTNKEAVYNNIMRHYLMQKLKNNRLKKENKPVIPLPQILGLTAS
PGVGGATKQAKAEEHILKLCANLDAFTIKTVKENLDQLKNQIQEPCKKFAIADATREDPFKEKLLEIMTR
IQTYCQMSPMSDFGTQPYEQWAIQMEKKAAKEGNRKERVCAEHLRKYNEALQINDTIRMIDAYTHLETFY
NEEKDKKFAVIEDDSDEGGDDEYCDGDEDEDDLKKPLKLDETDRFLMTLFFENNKMLKRLAENPEYENEK
LTKLRNTIMEQYTRTEESARGIIFTKTRQSAYALSQWITENEKFAEVGVKAHHLIGAGHSSEFKPMTQNE
QKEVISKFRTGKINLLIATTVAEEGLDIKECNIVIRYGLVTNEIAMVQARGRARADESTYVLVAHSGSGV
IERETVNDFREKMMYKAIHCVQNMKPEEYAHKILELQMQSIMEKKMKTKRNIAKHYKNNLSLITFLCKNC
SVLACSGEDIHVIEKMHHVNMTPEFKELYIVRENKTLQKKCADYQINGEIICKCGQAWGTMMVHKGLDLP
CLKIRNFVVVFKNNSTKKQYKKWVELPITFPNLDYSECCLFSDED

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_022168
ORF Size 3075 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_022168.4
RefSeq Size 3434 bp
RefSeq ORF 3078 bp
Locus ID 64135
UniProt ID Q9BYX4
Cytogenetics 2q24.2
Domains DEAD, helicase_C
Protein Pathways RIG-I-like receptor signaling pathway
MW 116.5 kDa
Gene Summary IFIH1 encodes MDA5 which is an intracellular sensor of viral RNA that triggers the innate immune response. Sensing RNA length and secondary structure, MDA5 binds dsRNA oligonucleotides with a modified DExD/H-box helicase core and a C-terminal domain, thus leading to a proinflammatory response that includes interferons. It has been shown that Coronaviruses (CoVs) as well as various other virus families, are capable of evading the MDA5-dependent interferon response, thus impeding the activation of the innate immune response to infection. MDA5 has also been shown to play an important role in enhancing natural killer cell function in malaria infection. In addition to its protective role in antiviral responses, MDA5 has been implicated in autoimmune and autoinflammatory diseases such as type 1 diabetes, systemic lupus erythematosus, and Aicardi-Goutieres syndrome[provided by RefSeq, Jul 2020]

Other Versions

Other products for "IFIH1"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


IFIH1 (MDA5) mouse monoclonal antibody, clone OTI8C10 (formerly 8C10)
    • 100 ul

USD 417.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.