ULK1 (NM_003565) Human Tagged ORF Clone

CAT#: RC215643

Reviews ()
Write a review

ULK1 (Myc-DDK-tagged)-Human unc-51-like kinase 1 (C. elegans) (ULK1)



  "NM_003565" in other vectors (6)

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 997.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ULK1
Synonyms ATG1; ATG1A; hATG1; UNC51; Unc51.1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC215643 representing NM_003565
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGCCCGGCCGCGGCGGCACAGAGACCGTGGGCAAGTTCGAGTTCTCCCGCAAGGACCTGATCGGCC
ACGGCGCCTTCGCGGTGGTCTTCAAGGGCCGCCACCGCGAGAAGCACGATTTGGAGGTCGCCGTCAAGTG
CATTAACAAGAAGAACCTCGCCAAGTCTCAGACGCTGCTGGGGAAGGAAATCAAAATCCTGAAGGAACTG
AAACATGAAAACATCGTGGCCCTGTACGACTTCCAGGAAATGGCTAATTCTGTCTACCTGGTTATGGAGT
ACTGCAACGGTGGGGACCTGGCCGACTACCTGCACGCCATGCGCACGCTGAGCGAGGACACCATCAGGCT
CTTCCTGCAGCAGATCGCGGGCGCCATGCGGCTTCTGCACAGCAAAGGCATCATCCACCGCGACCTGAAA
CCGCAGAACATCCTGCTGTCCAACCCCGCCGGCCGCCGCGCCAACCCCAACAGCATCCGCGTCAAGATCG
CTGACTTCGGCTTCGCGCGGTACCTCCAGAGCAACATGATGGCGGCCACACTCTGCGGCTCCCCCATGTA
CATGGCCCCCGAGGTCATCATGTCCCAGCACTACGACGGGAAGGCGGACCTGTGGAGCATCGGCACCATC
GTCTACCAGTGCCTGACGGGGAAGGCGCCCTTCCAGGCCAGCAGCCCCCAGGACCTGCGCCTGTTCTACG
AGAAGAACAAGACGTTGGTCCCCACCATCCCCCGGGAGACCTCGGCCCCGCTGCGGCAGCTGCTCCTGGC
CCTACTGCAACGCAACCACAAGGACCGCATGGACTTCGATGAGTTTTTTCATCACCCTTTCCTCGATGCC
AGCCCCTCGGTCAGGAAATCCCCACCCGTGCCTGTGCCCTCGTACCCAAGCTCGGGGTCCGGCAGCAGCT
CCAGCAGCAGCTCCACCTCCCACCTGGCCTCCCCGCCGTCCCTGGGCGAGATGCAGCAGCTGCAGAAGAC
CCTGGCCTCCCCGGCTGACACCGCTGGCTTCCTGCACAGCTCCCGGGACTCTGGTGGCAGCAAGGACTCT
TCCTGTGACACAGACGACTTCGTCATGGTCCCCGCGCAGTTTCCAGGTGACCTGGTGGCTGAGGCGCCCA
GTGCCAAACCCCCGCCAGACAGCCTGATGTGCAGTGGGAGCTCACTGGTGGCCTCTGCGGGCTTGGAGAG
CCACGGCCGGACCCCATCTCCATCCCCACCCTGCAGCAGCTCCCCCAGTCCCTCAGGCCGGGCTGGCCCG
TTCTCCAGCAGCAGGTGCGGCGCCTCTGTCCCCATCCCAGTCCCCACGCAGGTGCAGAACTACCAGCGCA
TTGAGCGAAACCTGCAGTCACCCACCCAGTTCCAAACACCTCGGTCCTCTGCCATCCGCAGGTCAGGCAG
CACCAGCCCCCTGGGCTTTGCAAGGGCCAGCCCCTCGCCCCCTGCCCACGCTGAGCATGGAGGCGTCCTG
GCCAGGAAGATGTCTCTGGGTGGAGGCCGGCCCTACACGCCATCTCCTCAAGTTGGAACCATCCCTGAGC
GGCCAGGCTGGAGCGGGACGCCCTCCCCACAGGGAGCTGAGATGCGGGGTGGCAGGTCCCCTCGTCCAGG
CTCCTCTGCACCCGAGCACTCTCCCCGCACTTCCGGGCTGGGCTGCCGCCTGCACAGCGCCCCCAACCTG
TCTGACTTGCACGTCGTCCGCCCCAAGCTGCCCAAACCCCCCACGGACCCCCTGGGAGCTGTGTTCAGCC
CACCACAGGCCAGCCCTCCCCAGCCGTCCCACGGCCTGCAGTCCTGCCGGAACCTGCGGGGCTCACCCAA
GCTGCCCGACTTCCTGCAGCGAAACCCCCTGCCCCCCATCCTGGGCTCCCCCACCAAGGCTGTGCCCTCC
TTTGACTTCCCGAAGACCCCCAGCTCCCAGAACCTGCTGGCCCTCCTAGCCCGGCAGGGCGTGGTGATGA
CGCCCCCTCGAAACCGGACGCTGCCCGACCTCTCGGAGGTGGGACCCTTCCATGGTCAGCCGTTGGGCCC
TGGCCTGCGGCCAGGCGAGGACCCCAAGGGCCCCTTTGGCCGGTCTTTCAGCACCAGCCGCCTCACTGAC
CTGCTCCTTAAGGCGGCGTTTGGGACACAAGCCCCGGACCCGGGCAGCACGGAGAGCCTGCAGGAGAAGC
CCATGGAGATCGCACCCTCAGCTGGCTTTGGAGGGAGCCTGCACCCAGGAGCCCGTGCTGGGGGCACCAG
CAGCCCTTCCCCGGTGGTCTTCACCGTGGGCTCTCCCCCGAGCGGGAGCACGCCCCCCCAGGGCCCCCGC
ACCAGGATGTTCTCAGCGGGCCCCACTGGCTCTGCCAGCTCTTCTGCCCGCCACCTGGTGCCTGGGCCCT
GCAGCGAGGCCCCAGCCCCTGAGCTCCCTGCTCCAGGACACGGCTGCAGCTTTGCCGACCCCATTACTGC
GAACCTGGAGGGGGCTGTGACCTTCGAGGCCCCCGACCTCCCTGAGGAGACCCTCATGGAGCAAGAGCAC
ACGGAGATCCTGCGTGGCCTGCGCTTCACGCTGCTGTTCGTGCAGCACGTCCTGGAGATCGCAGCCCTGA
AGGGCAGCGCCAGTGAGGCGGCGGGGGGCCCTGAGTACCAGCTGCAGGAGAGTGTGGTGGCCGACCAGAT
CAGCCTGCTGAGCCGAGAATGGGGCTTCGCGGAACAGCTGGTGCTGTACCTGAAGGTGGCCGAGCTACTG
TCCTCCGGCCTGCAAAGTGCCATCGACCAGATCCGGGCCGGCAAGCTCTGCCTGTCGTCCACTGTGAAGC
AGGTGGTGCGCAGGCTGAATGAGCTGTACAAGGCCAGCGTGGTGTCCTGCCAGGGCCTGAGCCTGCGGCT
GCAGCGCTTCTTCCTGGACAAGCAGCGGCTCCTGGACCGCATTCACAGCATCACTGCCGAGAGGCTCATC
TTCAGCCACGCTGTGCAGATGGTGCAGTCGGCTGCCCTGGACGAGATGTTCCAGCACCGTGAGGGCTGCG
TCCCACGCTACCACAAGGCCCTGCTGCTCCTGGAGGGGCTGCAGCACATGCTCTCGGACCAGGCCGACAT
CGAGAACGTCACCAAGTGCAAGCTGTGCATTGAGCGGAGACTCTCGGCGCTGCTGACTGGCATCTGTGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC215643 representing NM_003565
Red=Cloning site Green=Tags(s)

MEPGRGGTETVGKFEFSRKDLIGHGAFAVVFKGRHREKHDLEVAVKCINKKNLAKSQTLLGKEIKILKEL
KHENIVALYDFQEMANSVYLVMEYCNGGDLADYLHAMRTLSEDTIRLFLQQIAGAMRLLHSKGIIHRDLK
PQNILLSNPAGRRANPNSIRVKIADFGFARYLQSNMMAATLCGSPMYMAPEVIMSQHYDGKADLWSIGTI
VYQCLTGKAPFQASSPQDLRLFYEKNKTLVPTIPRETSAPLRQLLLALLQRNHKDRMDFDEFFHHPFLDA
SPSVRKSPPVPVPSYPSSGSGSSSSSSSTSHLASPPSLGEMQQLQKTLASPADTAGFLHSSRDSGGSKDS
SCDTDDFVMVPAQFPGDLVAEAPSAKPPPDSLMCSGSSLVASAGLESHGRTPSPSPPCSSSPSPSGRAGP
FSSSRCGASVPIPVPTQVQNYQRIERNLQSPTQFQTPRSSAIRRSGSTSPLGFARASPSPPAHAEHGGVL
ARKMSLGGGRPYTPSPQVGTIPERPGWSGTPSPQGAEMRGGRSPRPGSSAPEHSPRTSGLGCRLHSAPNL
SDLHVVRPKLPKPPTDPLGAVFSPPQASPPQPSHGLQSCRNLRGSPKLPDFLQRNPLPPILGSPTKAVPS
FDFPKTPSSQNLLALLARQGVVMTPPRNRTLPDLSEVGPFHGQPLGPGLRPGEDPKGPFGRSFSTSRLTD
LLLKAAFGTQAPDPGSTESLQEKPMEIAPSAGFGGSLHPGARAGGTSSPSPVVFTVGSPPSGSTPPQGPR
TRMFSAGPTGSASSSARHLVPGPCSEAPAPELPAPGHGCSFADPITANLEGAVTFEAPDLPEETLMEQEH
TEILRGLRFTLLFVQHVLEIAALKGSASEAAGGPEYQLQESVVADQISLLSREWGFAEQLVLYLKVAELL
SSGLQSAIDQIRAGKLCLSSTVKQVVRRLNELYKASVVSCQGLSLRLQRFFLDKQRLLDRIHSITAERLI
FSHAVQMVQSAALDEMFQHREGCVPRYHKALLLLEGLQHMLSDQADIENVTKCKLCIERRLSALLTGICA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_003565
ORF Size 3150 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_003565.4
RefSeq Size 5228 bp
RefSeq ORF 3153 bp
Locus ID 8408
UniProt ID O75385
Cytogenetics 12q24.33
Protein Families Druggable Genome, Protein Kinase
Protein Pathways mTOR signaling pathway, Regulation of autophagy
MW 112.4 kDa
Gene Summary Serine/threonine-protein kinase involved in autophagy in response to starvation. Acts upstream of phosphatidylinositol 3-kinase PIK3C3 to regulate the formation of autophagophores, the precursors of autophagosomes. Part of regulatory feedback loops in autophagy: acts both as a downstream effector and negative regulator of mammalian target of rapamycin complex 1 (mTORC1) via interaction with RPTOR. Activated via phosphorylation by AMPK and also acts as a regulator of AMPK by mediating phosphorylation of AMPK subunits PRKAA1, PRKAB2 and PRKAG1, leading to negatively regulate AMPK activity. May phosphorylate ATG13/KIAA0652 and RPTOR; however such data need additional evidences. Plays a role early in neuronal differentiation and is required for granule cell axon formation. May also phosphorylate SESN2 and SQSTM1 to regulate autophagy (PubMed:25040165).[UniProtKB/Swiss-Prot Function]

Other Versions

Other products for "ULK1"
Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.