Kir4.1 (KCNJ10) (NM_002241) Human Tagged ORF Clone

CAT#: RC213543

Reviews ()
Write a review

KCNJ10 (Myc-DDK-tagged)-Human potassium inwardly-rectifying channel, subfamily J, member 10 (KCNJ10)



Reconstitution Protocol

USD 457.00

In Stock*

Size
    • 10 ug

Product images

Other products for "KCNJ10"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol KCNJ10
Synonyms BIRK-10; KCNJ13-PEN; KIR1.2; KIR4.1; SESAME
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC213543 representing NM_002241
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACGTCAGTTGCCAAGGTGTATTACAGTCAGACCACTCAGACAGAAAGCCGGCCCCTAATGGGCCCAG
GGATACGACGGCGGAGAGTCCTGACAAAAGATGGTCGCAGCAACGTGAGAATGGAGCACATTGCCGACAA
GCGCTTCCTCTACCTCAAGGACCTGTGGACAACCTTCATTGACATGCAGTGGCGCTACAAGCTTCTGCTC
TTCTCTGCGACCTTTGCAGGCACATGGTTCCTCTTTGGCGTGGTGTGGTATCTGGTAGCTGTGGCACATG
GGGACCTGCTGGAGCTGGACCCCCCGGCCAACCACACCCCCTGTGTGGTACAGGTGCACACACTCACTGG
AGCCTTCCTCTTCTCCCTTGAATCCCAAACCACCATTGGCTATGGCTTCCGCTACATCAGTGAGGAATGT
CCACTGGCCATTGTGCTTCTTATTGCCCAGCTGGTGCTCACCACCATCCTGGAAATCTTCATCACAGGTA
CCTTCCTGGCGAAGATTGCCCGGCCCAAGAAGCGGGCTGAGACCATTCGTTTCAGCCAGCATGCAGTTGT
GGCCTCCCACAATGGCAAGCCCTGCCTCATGATCCGAGTTGCCAATATGCGCAAAAGCCTCCTCATTGGC
TGCCAGGTGACAGGAAAACTGCTTCAGACCCACCAAACCAAGGAAGGGGAGAACATCCGGCTCAACCAGG
TCAATGTGACTTTCCAAGTAGACACAGCCTCTGACAGCCCCTTCCTTATTCTACCCCTTACCTTCTATCA
TGTGGTAGATGAGACCAGTCCCTTGAAAGATCTCCCTCTTCGCAGTGGTGAGGGTGACTTTGAGCTGGTG
CTGATCCTAAGTGGGACAGTGGAGTCCACCAGTGCCACCTGTCAGGTGCGCACTTCCTACCTGCCAGAGG
AGATCCTTTGGGGCTACGAGTTCACACCTGCCATCTCACTGTCAGCCAGTGGTAAATACATAGCTGACTT
TAGCCTTTTTGACCAAGTTGTGAAAGTGGCCTCTCCTAGTGGCCTCCGTGACAGCACTGTACGCTACGGA
GACCCTGAAAAGCTCAAGTTGGAGGAGTCATTAAGGGAGCAAGCTGAGAAGGAGGGCAGTGCCCTTAGTG
TGCGCATCAGCAATGTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC213543 representing NM_002241
Red=Cloning site Green=Tags(s)

MTSVAKVYYSQTTQTESRPLMGPGIRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFIDMQWRYKLLL
FSATFAGTWFLFGVVWYLVAVAHGDLLELDPPANHTPCVVQVHTLTGAFLFSLESQTTIGYGFRYISEEC
PLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIRFSQHAVVASHNGKPCLMIRVANMRKSLLIG
CQVTGKLLQTHQTKEGENIRLNQVNVTFQVDTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELV
LILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYG
DPEKLKLEESLREQAEKEGSALSVRISNV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_002241
ORF Size 1137 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_002241.5
RefSeq Size 4515 bp
RefSeq ORF 1140 bp
Locus ID 3766
UniProt ID P78508
Cytogenetics 1q23.2
Domains IRK
Protein Families Druggable Genome, Ion Channels: Potassium, Transmembrane
MW 42.3 kDa
Gene Summary This gene encodes a member of the inward rectifier-type potassium channel family, characterized by having a greater tendency to allow potassium to flow into, rather than out of, a cell. The encoded protein may form a heterodimer with another potassium channel protein and may be responsible for the potassium buffering action of glial cells in the brain. Mutations in this gene have been associated with seizure susceptibility of common idiopathic generalized epilepsy syndromes. [provided by RefSeq, Jul 2008]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.