Glucagon Receptor(GCGR) (NM_000160) Human Tagged ORF Clone

CAT#: RC211179

GCGR (Myc-DDK-tagged)-Human glucagon receptor (GCGR)

Change vector?

USD 577


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Glucagon Receptor(GCGR) (NM_000160) Human Tagged ORF Clone
Symbol GCGR
Synonyms GGR; GL-R
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC211179 representing NM_000160
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCCCCCTGCCAGCCACAGCGACCCCTGCTGCTGTTGCTGCTGCTGCTGGCCTGCCAGCCACAGGTCC
CCTCCGCTCAGGTGATGGACTTCCTGTTTGAGAAGTGGAAGCTCTACGGTGACCAGTGTCACCACAACCT
GAGCCTGCTGCCCCCTCCCACGGAGCTGGTGTGCAACAGAACCTTCGACAAGTATTCCTGCTGGCCGGAC
ACCCCCGCCAATACCACGGCCAACATCTCCTGCCCCTGGTACCTGCCTTGGCACCACAAAGTGCAACACC
GCTTCGTGTTCAAGAGATGCGGGCCCGACGGTCAGTGGGTGCGTGGACCCCGGGGGCAGCCTTGGCGTGA
TGCCTCCCAGTGCCAGATGGATGGCGAGGAGATTGAGGTCCAGAAGGAGGTGGCCAAGATGTACAGCAGC
TTCCAGGTGATGTACACAGTGGGCTACAGCCTGTCCCTGGGGGCCCTGCTCCTCGCCTTGGCCATCCTGG
GGGGCCTCAGCAAGCTGCACTGCACCCGCAATGCCATCCACGCGAATCTGTTTGCGTCCTTCGTGCTGAA
AGCCAGCTCCGTGCTGGTCATTGATGGGCTGCTCAGGACCCGCTACAGCCAGAAAATTGGCGACGACCTC
AGTGTCAGCACCTGGCTCAGTGATGGAGCGGTGGCTGGCTGCCGTGTGGCCGCGGTGTTCATGCAATATG
GCATCGTGGCCAACTACTGCTGGCTGCTGGTGGAGGGCCTGTACCTGCACAACCTGCTGGGCCTGGCCAC
CCTCCCCGAGAGGAGCTTCTTCAGCCTCTACCTGGGCATCGGCTGGGGTGCCCCCATGCTGTTCGTCGTC
CCCTGGGCAGTGGTCAAGTGTCTGTTCGAGAACGTCCAGTGCTGGACCAGCAATGACAACATGGGCTTCT
GGTGGATCCTGCGGTTCCCCGTCTTCCTGGCCATCCTGATCAACTTCTTCATCTTCGTCCGCATCGTTCA
GCTGCTCGTGGCCAAGCTGCGGGCACGGCAGATGCACCACACAGACTACAAGTTCCGGCTGGCCAAGTCC
ACGCTGACCCTCATCCCTCTGCTGGGCGTCCACGAAGTGGTCTTCGCCTTCGTGACGGACGAGCACGCCC
AGGGCACCCTGCGCTCCGCCAAGCTCTTCTTCGACCTCTTCCTCAGCTCCTTCCAGGGCCTGCTGGTGGC
TGTCCTCTACTGCTTCCTCAACAAGGAGGTGCAGTCGGAGCTGCGGCGGCGTTGGCACCGCTGGCGCCTG
GGCAAAGTGCTATGGGAGGAGCGGAACACCAGCAACCACAGGGCCTCATCTTCGCCCGGCCACGGCCCTC
CCAGCAAGGAGCTGCAGTTTGGGAGGGGTGGTGGCAGCCAGGATTCATCTGCGGAGACCCCCTTGGCTGG
TGGCCTCCCTAGATTGGCTGAGAGCCCCTTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC211179 representing NM_000160
Red=Cloning site Green=Tags(s)

MPPCQPQRPLLLLLLLLACQPQVPSAQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPD
TPANTTANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAKMYSS
FQVMYTVGYSLSLGALLLALAILGGLSKLHCTRNAIHANLFASFVLKASSVLVIDGLLRTRYSQKIGDDL
SVSTWLSDGAVAGCRVAAVFMQYGIVANYCWLLVEGLYLHNLLGLATLPERSFFSLYLGIGWGAPMLFVV
PWAVVKCLFENVQCWTSNDNMGFWWILRFPVFLAILINFFIFVRIVQLLVAKLRARQMHHTDYKFRLAKS
TLTLIPLLGVHEVVFAFVTDEHAQGTLRSAKLFFDLFLSSFQGLLVAVLYCFLNKEVQSELRRRWHRWRL
GKVLWEERNTSNHRASSSPGHGPPSKELQFGRGGGSQDSSAETPLAGGLPRLAESPF

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_000160
ORF Size 1431 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_000160.1, NM_000160.2, NM_000160.3, NM_000160.4, NP_000151
RefSeq Size 2034
RefSeq ORF 1434
Locus ID 2642
Cytogenetics 17q25.3
Protein Families GPCR, Transmembrane, Druggable Genome
Protein Pathways Neuroactive ligand-receptor interaction
MW 54.01 kDa
Gene Summary The protein encoded by this gene is a glucagon receptor that is important in controlling blood glucose levels. Defects in this gene are a cause of non-insulin-dependent diabetes mellitus (NIDDM).[provided by RefSeq, Jan 2010]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations