G6PC2 (NM_021176) Human Tagged ORF Clone

CAT#: RC211146

G6PC2 (Myc-DDK-tagged)-Human glucose-6-phosphatase, catalytic, 2 (G6PC2), transcript variant 1

Change vector?

USD 577


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name G6PC2 (NM_021176) Human Tagged ORF Clone
Symbol G6PC2
Synonyms IGRP
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC211146 representing NM_021176
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATTTCCTTCACAGGAATGGAGTGCTCATAATTCAGCATTTGCAGAAGGACTACCGAGCTTACTACA
CTTTTCTAAATTTTATGTCCAATGTTGGAGACCCCAGGAATATCTTTTTCATTTATTTTCCACTTTGTTT
TCAATTTAATCAGACAGTTGGAACCAAGATGATATGGGTAGCAGTCATTGGGGATTGGTTAAATCTTATA
TTTAAATGGATATTATTTGGTCATCGACCTTACTGGTGGGTCCAAGAAACTCAGATTTACCCAAATCACT
CAAGTCCATGCCTTGAACAGTTCCCTACTACATGTGAAACAGGTCCAGGAAGTCCATCTGGCCATGCAAT
GGGCGCATCCTGTGTCTGGTATGTCATGGTAACCGCTGCCCTGAGCCACACTGTCTGTGGGATGGATAAG
TTCTCTATCACTCTGCACAGACTGACCTGGTCATTTCTTTGGAGTGTTTTTTGGTTGATTCAAATCAGTG
TCTGCATCTCCAGAGTATTCATAGCAACACATTTTCCTCATCAAGTTATTCTTGGAGTAATTGGTGGCAT
GCTGGTGGCAGAGGCCTTTGAACACACTCCAGGCATCCAAACGGCCAGTCTGGGCACATACCTGAAGACC
AACCTCTTTCTCTTCCTGTTTGCAGTTGGCTTTTACCTGCTTCTTAGGGTGCTCAACATTGACCTGCTGT
GGTCCGTGCCCATAGCCAAAAAGTGGTGTGCTAACCCCGACTGGATCCACATTGACACCACGCCTTTTGC
TGGACTCGTGAGAAACCTTGGGGTCCTCTTTGGCTTGGGCTTTGCAATCAACTCAGAGATGTTCCTCCTG
AGCTGCCGAGGGGGAAATAACTACACACTGAGCTTCCGGTTGCTCTGTGCCTTGACCTCATTGACAATAC
TGCAGCTCTACCATTTCCTCCAGATCCCGACTCACGAAGAGCATTTATTTTATGTGCTGTCTTTTTGTAA
AAGTGCATCCATTCCCCTAACTGTGGTTGCTTTCATTCCCTACTCTGTTCATATGTTAATGAAACAAAGC
GGAAAGAAGAGTCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC211146 representing NM_021176
Red=Cloning site Green=Tags(s)

MDFLHRNGVLIIQHLQKDYRAYYTFLNFMSNVGDPRNIFFIYFPLCFQFNQTVGTKMIWVAVIGDWLNLI
FKWILFGHRPYWWVQETQIYPNHSSPCLEQFPTTCETGPGSPSGHAMGASCVWYVMVTAALSHTVCGMDK
FSITLHRLTWSFLWSVFWLIQISVCISRVFIATHFPHQVILGVIGGMLVAEAFEHTPGIQTASLGTYLKT
NLFLFLFAVGFYLLLRVLNIDLLWSVPIAKKWCANPDWIHIDTTPFAGLVRNLGVLFGLGFAINSEMFLL
SCRGGNNYTLSFRLLCALTSLTILQLYHFLQIPTHEEHLFYVLSFCKSASIPLTVVAFIPYSVHMLMKQS
GKKSQ

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_021176
ORF Size 1065 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_021176.1, NM_021176.2, NP_066999
RefSeq Size 3096
RefSeq ORF 1068
Locus ID 57818
Cytogenetics 2q31.1
Protein Families Transmembrane, Druggable Genome
Protein Pathways Glycolysis / Gluconeogenesis, Galactose metabolism, Starch and sucrose metabolism, Metabolic pathways, Insulin signaling pathway, Adipocytokine signaling pathway
MW 40.4 kDa
Gene Summary This gene encodes an enzyme belonging to the glucose-6-phosphatase catalytic subunit family. These enzymes are part of a multicomponent integral membrane system that catalyzes the hydrolysis of glucose-6-phosphate, the terminal step in gluconeogenic and glycogenolytic pathways, allowing the release of glucose into the bloodstream. The family member encoded by this gene is found in pancreatic islets and does not exhibit phosphohydrolase activity, but it is a major target of cell-mediated autoimmunity in diabetes. Several alternatively spliced transcript variants of this gene have been described, but their biological validity has not been determined. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations