RAB21 (NM_014999) Human Tagged ORF Clone

CAT#: RC210510

Reviews ()
Write a review

RAB21 (Myc-DDK-tagged)-Human RAB21, member RAS oncogene family (RAB21)



  "NM_014999" in other vectors (6)

Reconstitution Protocol

USD 300.00

USD 450.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "RAB21"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol RAB21
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC210510 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGCGGCCGGCGGCGGCGGCGGCGGGGCGGCGGCGGCGGGCCGAGCCTACTCGTTCAAGGTGGTGC
TGCTGGGGGAAGGCTGCGTGGGGAAGACGTCGCTGGTGCTGCGCTACTGCGAGAACAAGTTTAACGACAA
GCACATCACCACTCTGCAGGCATCATTCTTAACAAAGAAGTTAAATATTGGTGGGAAAAGAGTAAACCTT
GCCATATGGGATACGGCAGGTCAAGAGAGATTCCATGCATTGGGTCCAATTTACTACAGAGATTCAAATG
GAGCGATTTTAGTTTATGACATAACAGATGAAGATTCTTTTCAGAAGGTAAAAAACTGGGTCAAAGAATT
ACGGAAAATGTTGGGAAATGAAATCTGTTTATGTATAGTTGGTAATAAAATAGACTTGGAAAAGGAGAGA
CATGTTTCCATTCAAGAAGCAGAGTCGTATGCAGAATCTGTGGGAGCAAAACATTATCATACTTCAGCCA
AACAGAACAAAGGAATTGAGGAACTCTTTCTTGACCTTTGTAAAAGGATGATAGAAACAGCACAAGTGGA
TGAGAGAGCAAAAGGCAATGGCTCTAGTCAGCCGGGAACTGCAAGGCGAGGTGTACAGATTATTGATGAT
GAACCTCAAGCCCAGACCAGTGGTGGAGGGTGCTGTTCTTCTGGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC210510 protein sequence
Red=Cloning site Green=Tags(s)

MAAAGGGGGGAAAAGRAYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKKLNIGGKRVNL
AIWDTAGQERFHALGPIYYRDSNGAILVYDITDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKER
HVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGNGSSQPGTARRGVQIIDD
EPQAQTSGGGCCSSG

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_014999
ORF Size 675 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_014999.4
RefSeq Size 2627 bp
RefSeq ORF 678 bp
Locus ID 23011
UniProt ID Q9UL25
Cytogenetics 12q21.1
Domains ras, RAN, RAS, RHO, RAB
Protein Families Druggable Genome
MW 24.3 kDa
Gene Summary This gene belongs to the Rab family of monomeric GTPases, which are involved in the control of cellular membrane traffic. The encoded protein plays a role in the targeted trafficking of integrins via its association with integrin alpha tails. As a consequence, the encoded protein is involved in the regulation of cell adhesion and migration. Expression of this gene is associated with a poor prognosis for glioma patients. This gene is downregulated by the tumor suppressor miR-200b, and miRNA-200b is itself downregulated in glioma tissues. [provided by RefSeq, Nov 2015]

Other Versions

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.