CD2AP (NM_012120) Human Tagged ORF Clone

CAT#: RC210191

CD2AP (Myc-DDK-tagged)-Human CD2-associated protein (CD2AP)

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CD2AP (NM_012120) Human Tagged ORF Clone
Symbol CD2AP
Synonyms CMS
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC210191 representing NM_012120
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTTGACTATATTGTGGAGTATGACTATGATGCTGTACATGATGATGAATTAACTATTCGAGTTGGAG
AAATCATCAGGAATGTGAAAAAGCTACAGGAGGAAGGGTGGCTGGAAGGAGAACTAAATGGGAGAAGAGG
AATGTTCCCTGACAATTTCGTTAAGGAAATTAAAAGAGAGACGGAATTCAAGGATGACAGTTTGCCCATC
AAACGGGAAAGGCATGGGAATGTAGCAAGTCTTGTACAACGAATAAGCACCTATGGACTTCCAGCTGGAG
GAATTCAGCCACATCCACAAACCAAAAACATTAAGAAGAAGACCAAGAAGCGTCAGTGTAAAGTTCTTTT
TGAGTACATTCCACAAAATGAGGATGAACTGGAGCTGAAAGTGGGAGATATTATTGATATTAATGAAGAG
GTAGAAGAAGGCTGGTGGAGTGGAACCCTGAATAACAAGTTGGGACTGTTTCCCTCAAATTTTGTGAAAG
AATTAGAGGTAACAGATGATGGTGAAACTCATGAAGCCCAGGACGATTCAGAAACTGTTTTGGCTGGGCC
TACTTCACCTATACCTTCTCTGGGAAATGTGAGTGAAACTGCATCTGGATCAGTTACACAGCCAAAGAAA
ATTCGAGGAATTGGATTTGGAGACATTTTTAAAGAAGGCTCTGTGAAACTTCGGACAAGAACATCCAGTA
GTGAAACAGAAGAGAAAAAACCAGAAAAGCCCTTAATCCTACAGTCACTGGGACCCAAAACTCAGAGTGT
GGAGATAACAAAAACAGATACCGAAGGTAAAATTAAAGCTAAAGAATATTGTAGAACATTATTTGCCTAT
GAAGGTACTAATGAAGATGAACTTACTTTTAAAGAGGGGGAGATAATCCATTTGATAAGTAAGGAGACTG
GAGAAGCTGGCTGGTGGAGGGGCGAACTTAATGGTAAAGAAGGAGTATTTCCAGACAATTTTGCTGTCCA
GATAAATGAACTTGATAAAGACTTTCCAAAACCAAAGAAACCACCACCTCCTGCTAAGGCTCCAGCTCCA
AAGCCTGAACTGATAGCTGCAGAGAAGAAATATTTTTCTTTAAAGCCTGAAGAAAAGGATGAAAAATCAA
CACTGGAACAGAAACCTTCTAAACCAGCAGCTCCACAAGTCCCACCCAAGAAACCTACTCCACCTACCAA
AGCCAGTAATTTATTGAGATCTTCTGGAACAGTGTACCCAAAGCGACCTGAAAAACCAGTTCCTCCACCA
CCTCCTATAGCCAAGATTAATGGGGAAGTTTCTAGCATTTCATCAAAATTTGAAACTGAGCCAGTATCAA
AACTAAAGCTAGATTCTGAACAGCTGCCCCTTAGACCAAAATCAGTAGACTTTGATTCACTTACAGTAAG
GACCTCCAAAGAAACAGATGTTGTAAATTTTGATGACATAGCTTCCTCAGAAAACTTGCTTCATCTCACT
GCAAATAGACCAAAGATGCCTGGAAGAAGGTTGCCGGGCCGTTTCAATGGTGGACATTCTCCAACTCACA
GCCCCGAAAAAATCTTGAAGTTACCAAAAGAAGAAGACAGTGCCAACCTGAAGCCATCTGAATTAAAAAA
AGATACATGCTACTCTCCAAAGCCATCTGTGTACCTTTCAACACCTTCCAGTGCTTCTAAAGCAAATACA
ACTGCTTTCCTGACTCCATTAGAAATCAAAGCTAAAGTGGAAACAGATGATGTGAAAAAAAATTCCCTGG
ATGAACTTAGAGCCCAGATTATTGAATTGTTGTGCATTGTAGAAGCACTGAAAAAGGATCACGGGAAAGA
ACTGGAAAAACTGCGAAAAGATTTGGAAGAAGAGAAGACAATGAGAAGTAATCTAGAGATGGAAATAGAG
AAGCTGAAAAAAGCTGTCCTGTCTTCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC210191 representing NM_012120
Red=Cloning site Green=Tags(s)

MVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKRETEFKDDSLPI
KRERHGNVASLVQRISTYGLPAGGIQPHPQTKNIKKKTKKRQCKVLFEYIPQNEDELELKVGDIIDINEE
VEEGWWSGTLNNKLGLFPSNFVKELEVTDDGETHEAQDDSETVLAGPTSPIPSLGNVSETASGSVTQPKK
IRGIGFGDIFKEGSVKLRTRTSSSETEEKKPEKPLILQSLGPKTQSVEITKTDTEGKIKAKEYCRTLFAY
EGTNEDELTFKEGEIIHLISKETGEAGWWRGELNGKEGVFPDNFAVQINELDKDFPKPKKPPPPAKAPAP
KPELIAAEKKYFSLKPEEKDEKSTLEQKPSKPAAPQVPPKKPTPPTKASNLLRSSGTVYPKRPEKPVPPP
PPIAKINGEVSSISSKFETEPVSKLKLDSEQLPLRPKSVDFDSLTVRTSKETDVVNFDDIASSENLLHLT
ANRPKMPGRRLPGRFNGGHSPTHSPEKILKLPKEEDSANLKPSELKKDTCYSPKPSVYLSTPSSASKANT
TAFLTPLEIKAKVETDDVKKNSLDELRAQIIELLCIVEALKKDHGKELEKLRKDLEEEKTMRSNLEMEIE
KLKKAVLSS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_012120
ORF Size 1917 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_012120.1, NM_012120.2, NP_036252
RefSeq Size 5425
RefSeq ORF 1920
Locus ID 23607
Cytogenetics 6p12.3
Domains SH3
Protein Families Druggable Genome
MW 71.3 kDa
Gene Summary This gene encodes a scaffolding molecule that regulates the actin cytoskeleton. The protein directly interacts with filamentous actin and a variety of cell membrane proteins through multiple actin binding sites, SH3 domains, and a proline-rich region containing binding sites for SH3 domains. The cytoplasmic protein localizes to membrane ruffles, lipid rafts, and the leading edges of cells. It is implicated in dynamic actin remodeling and membrane trafficking that occurs during receptor endocytosis and cytokinesis. Haploinsufficiency of this gene is implicated in susceptibility to glomerular disease. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)