BCL10 (NM_003921) Human Tagged ORF Clone

CAT#: RC208752

Product images

Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate

Specifications

Product Data

• Product Name: BCL10 (NM_003921) Human Tagged ORF Clone
• Symbol: BCL10
• Synonyms: c-E10; CARMEN; CIPER; CLAP; IMD37; mE10
• Vector: pCMV6-Entry
• Sequence Data:
  ORF Nucleotide Sequence

  >RC208752 representing NM_003921
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGAGCCCACCGCACCGTCCCTCACCGAGGAGGACCTCACTGAAGTGAAGAAGGACGCCTTAGAAAATT
  TACGTGTATACCTGTGTGAGAAAATCATAGCTGAGAGACATTTTGATCATCTACGTGCAAAAAAAATACT
  CAGTAGAGAAGACACTGAAGAAATTTCTTGTCGAACATCAAGTAGAAAAAGGGCTGGAAAATTGTTAGAC
  TACTTACAGGAAAACCCAAAAGGTCTGGACACCCTTGTTGAATCTATTCGGCGAGAAAAAACACAGAACT
  TCCTGATACAGAAGATTACAGATGAAGTGCTGAAACTTAGAAATATAAAACTAGAACATCTGAAAGGACT
  AAAATGTAGCAGTTGTGAACCTTTTCCAGATGGAGCCACGAACAACCTCTCCAGATCAAATTCAGATGAG
  AGTAATTTCTCTGAAAAACTGAGGGCATCCACTGTCATGTACCATCCAGAAGGAGAATCCAGCACGACGC
  CCTTTTTTTCTACTAATTCTTCTCTGAATTTGCCTGTTCTAGAAGTAGGCAGAACTGAAAATACCATCTT
  CTCTTCAACTACACTTCCCAGACCTGGGGACCCAGGGGCTCCTCCTTTGCCACCAGATCTACAGTTAGAA
  GAAGAAGGAACTTGTGCAAACTCTAGTGAGATGTTTCTTCCCTTAAGATCACGTACTGTTTCACGACAA
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC208752 representing NM_003921
  Red=Cloning site Green=Tags(s)
  
  MEPTAPSLTEEDLTEVKKDALENLRVYLCEKIIAERHFDHLRAKKILSREDTEEISCRTSSRKRAGKLLD
  YLQENPKGLDTLVESIRREKTQNFLIQKITDEVLKLRNIKLEHLKGLKCSSCEPFPDGATNNLSRSNSDE
  SNFSEKLRASTVMYHPEGESSTTPFFSTNSSLNLPVLEVGRTENTIFSSTTLPRPGDPGAPPLPPDLQLE
  EEGTCANSSEMFLPLRSRTVSRQ
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• Tag: Myc-DDK
• ACCN: NM_003921
• ORF Size: 699 bp
• OTI Disclaimer: Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.
  
  The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.

Reference Data

• RefSeq: NM_003921.1, NM_003921.2, NM_003921.3, NM_003921.4, NP_003912
• RefSeq Size: 3271
• RefSeq ORF: 702
• Locus ID: 8915
• Cytogenetics: 1p22.3
• Domains: CARD
• Protein Families: Druggable Genome
• Protein Pathways: T cell receptor signaling pathway, B cell receptor signaling pathway
• MW: 26.1 kDa
• Gene Summary: This gene was identified by its translocation in a case of mucosa-associated lymphoid tissue (MALT) lymphoma. The protein encoded by this gene contains a caspase recruitment domain (CARD), and has been shown to induce apoptosis and to activate NF-kappaB. This protein is reported to interact with other CARD domain containing proteins including CARD9, 10, 11 and 14, which are thought to function as upstream regulators in NF-kappaB signaling. This protein is found to form a complex with MALT1, a protein encoded by another gene known to be translocated in MALT lymphoma. MALT1 and this protein are thought to synergize in the activation of NF-kappaB, and the deregulation of either of them may contribute to the same pathogenetic process that leads to the malignancy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2016]

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.