BRD7 (NM_013263) Human Tagged ORF Clone

CAT#: RC208734

BRD7 (Myc-DDK-tagged)-Human bromodomain containing 7 (BRD7), transcript variant 2

Need custom modification / cloning service?
Get a free quote

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name BRD7 (NM_013263) Human Tagged ORF Clone
Symbol BRD7
Synonyms BP75; CELTIX1; NAG4
Vector pCMV6-Entry
Sequence Data
>RC208734 representing NM_013263
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCAAGAAGCACAAGAAGCACAAGTCGGACAAACACCTCTACGAGGAGTATGTAGAGAAGCCCTTGA
AGCTGGTCCTCAAAGTAGGAGGGAACGAAGTCACCGAACTCTCCACGGGCAGCTCGGGGCACGACTCCAG
CCTCTTCGAAGACAAAAACGATCATGACAAACACAAGGACAGAAAGCGGAAAAAGAGAAAGAAAGGAGAG
AAGCAGATTCCAGGGGAAGAAAAGGGGAGAAAACGGAGAAGAGTTAAGGAGGATAAAAAGAAGCGAGATC
GAGACCGGGTGGAGAATGAGGCAGAAAAAGATCTCCAGTGTCACGCCCCTGTGAGATTAGACTTGCCTCC
TGAGAAGCCTCTCACAAGCTCTTTAGCCAAACAAGAAGAAGTAGAACAGACACCCCTTCAAGAAGCTTTG
AATCAACTGATGAGACAATTGCAGAGAAAAGATCCAAGTGCTTTCTTTTCATTTCCTGTGACTGATTTTA
TTGCTCCTGGCTACTCCATGATCATTAAACACCCAATGGATTTTAGTACCATGAAAGAAAAGATCAAGAA
CAATGACTATCAGTCCATAGAAGAACTAAAGGATAACTTCAAACTAATGTGTACTAATGCCATGATTTAC
AATAAACCAGAGACCATTTATTATAAAGCTGCAAAGAAGCTGTTGCACTCAGGAATGAAAATTCTTAGCC
AGGAAAGAATTCAGAGCCTGAAGCAGAGCATAGACTTCATGGCTGACTTGCAGAAAACTCGAAAGCAGAA
AGATGGAACAGACACCTCACAGAGTGGGGAGGACGGAGGCTGCTGGCAGAGAGAGAGAGAGGACTCTGGA
GATGCCGAAGCACACGCCTTCAAGAGTCCCAGCAAAGAAAATAAAAAGAAAGACAAAGATATGCTTGAAG
ATAAGTTTAAAAGCAATAATTTAGAGAGAGAGCAGGAGCAGCTTGACCGCATCGTGAAGGAATCTGGAGG
AAAGCTGACCAGGCGGCTTGTGAACAGTCAGTGCGAATTTGAAAGAAGAAAACCAGATGGAACAACGACG
TTGGGACTTCTCCATCCTGTGGATCCCATTGTAGGAGAGCCAGGCTACTGCCCTGTGAGACTGGGAATGA
CAACTGGAAGACTTCAGTCTGGAGTGAATACTTTGCAGGGGTTCAAAGAGGATAAAAGGAACAAAGTCAC
TCCAGTGTTATATTTGAATTATGGGCCCTACAGTTCTTATGCACCGCATTATGACTCCACATTTGCAAAT
ATCAGCAAGGATGATTCTGATTTAATCTATTCAACCTATGGGGAAGACTCTGATCTTCCAAGTGATTTCA
GCATCCATGAGTTTTTGGCCACGTGCCAAGATTATCCGTATGTCATGGCAGATAGTTTACTGGATGTTTT
AACAAAAGGAGGGCATTCCAGGACCCTACAAGAGATGGAGATGTCATTGCCTGAAGATGAAGGCCATACT
AGGACACTTGACACAGCAAAAGAAATGGAGATTACAGAAGTAGAGCCACCAGGGCGTTTGGACTCCAGTA
CTCAAGACAGGCTCATAGCGCTGAAAGCAGTAACAAATTTTGGCGTTCCAGTTGAAGTTTTTGACTCTGA
AGAAGCTGAAATATTCCAGAAGAAACTTGATGAGACCACCAGATTGCTCAGGGAACTCCAGGAAGCCCAG
AATGAACGTTTGAGCACCAGACCCCCTCCGAACATGATCTGTCTCTTGGGTCCCTCATACAGAGAAATGC
ATCTTGCTGAACAAGTGACCAATAATCTTAAAGAACTTGCACAGCAAGTAACTCCAGGTGATATCGTAAG
CACGTATGGAGTTCGAAAAGCAATGGGGATTTCCATTCCTTCCCCCGTCATGGAAAACAACTTTGTGGAT
TTGACAGAAGACACTGAAGAACCTAAAAAGACGGATGTTGCTGAGTGTGGACCTGGTGGAAGT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC208734 representing NM_013263
Red=Cloning site Green=Tags(s)

MGKKHKKHKSDKHLYEEYVEKPLKLVLKVGGNEVTELSTGSSGHDSSLFEDKNDHDKHKDRKRKKRKKGE
KQIPGEEKGRKRRRVKEDKKKRDRDRVENEAEKDLQCHAPVRLDLPPEKPLTSSLAKQEEVEQTPLQEAL
NQLMRQLQRKDPSAFFSFPVTDFIAPGYSMIIKHPMDFSTMKEKIKNNDYQSIEELKDNFKLMCTNAMIY
NKPETIYYKAAKKLLHSGMKILSQERIQSLKQSIDFMADLQKTRKQKDGTDTSQSGEDGGCWQREREDSG
DAEAHAFKSPSKENKKKDKDMLEDKFKSNNLEREQEQLDRIVKESGGKLTRRLVNSQCEFERRKPDGTTT
LGLLHPVDPIVGEPGYCPVRLGMTTGRLQSGVNTLQGFKEDKRNKVTPVLYLNYGPYSSYAPHYDSTFAN
ISKDDSDLIYSTYGEDSDLPSDFSIHEFLATCQDYPYVMADSLLDVLTKGGHSRTLQEMEMSLPEDEGHT
RTLDTAKEMEITEVEPPGRLDSSTQDRLIALKAVTNFGVPVEVFDSEEAEIFQKKLDETTRLLRELQEAQ
NERLSTRPPPNMICLLGPSYREMHLAEQVTNNLKELAQQVTPGDIVSTYGVRKAMGISIPSPVMENNFVD
LTEDTEEPKKTDVAECGPGGS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_013263
ORF Size 1953 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_013263.1, NM_013263.2, NM_013263.3, NM_013263.4, NP_037395
RefSeq Size 2204
RefSeq ORF 1956
Locus ID 29117
Cytogenetics 16q12.1
Domains bromodomain
MW 74 kDa
Gene Summary This gene encodes a protein which is a member of the bromodomain-containing protein family. The product of this gene has been identified as a component of one form of the SWI/SNF chromatin remodeling complex, and as a protein which interacts with p53 and is required for p53-dependent oncogene-induced senescence which prevents tumor growth. Pseudogenes have been described on chromosomes 2, 3, 6, 13 and 14. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2010]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)